CAZyme Information: MGYG000002819_00311

Basic Information

• Species: Veillonella tobetsuensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella tobetsuensis
• CAZyme ID: MGYG000002819_00311
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000002819_1|CGC3	30195.46	6.6314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002819	1971073	MAG	United States	North America

• Gene Location: Start: 352793; End: 353569 Strand: +

Full Sequence      

MNIIVISDKENAERRENVCNEFGKYNLEFSFFDAIMANKMSKEELTTKALKDTFLTPSEI
GCALSHIGVYKKFLESNQKSIMICEDDIFITEYFDKTVIEKIREFVEFSDEPRLVVLQKS
IYHHKRVQNISENMNIYSARNLFCTHGYIINRAAAHNITSIQNPVRFEIDAFKFYYWLNL
CKLYCLDKDLILQQDEEVMASTVDSGTSSDSSGESQRTAKKNSAYKELYRQLSLKSKIIS
QYRRFEKACYKMFEGLDY

Enzyme Prediction     

No EC number prediction in MGYG000002819_00311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	172	3.2e-29	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	1.33e-24	3	172	2	127	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	1.80e-18	3	155	4	182	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	5.52e-18	1	184	3	198	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU33574.1	1.55e-117	1	258	1	252
QEH51070.1	9.80e-68	1	256	1	255
QEH26877.1	9.80e-68	1	256	1	255
QEH19911.1	9.80e-68	1	256	1	255
QQJ90846.1	1.39e-67	1	256	1	255

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05770	1.90e-11	1	180	1	181	Lipooligosaccharide biosynthesis protein LpsA OS=Mannheimia haemolytica OX=75985 GN=lpsA PE=3 SV=2
Q57125	1.06e-10	5	195	36	236	Putative glycosyltransferase HI_0765 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0765 PE=3 SV=1
Q17FB8	4.30e-09	3	158	325	489	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1
Q51116	1.33e-08	5	154	5	162	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtB PE=3 SV=2
P57033	2.06e-07	5	154	5	162	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lgtB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002819_00311.