CAZyme Information: MGYG000002823_01768

Basic Information

• Species: Enterobacter bugandensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter bugandensis
• CAZyme ID: MGYG000002823_01768
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146		16583.09	7.4254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002823	4424695	MAG	Singapore	Asia

• Gene Location: Start: 41737; End: 42177 Strand: -

Full Sequence      

MKKFILLLLIISHGALANCWNNAAHYYHVDPYLLYAIANVESGMNPYAVGQNHDGTRDVG
LMQINSSHFTELESKGIDEYQLMAEPCTSIMVGASILSNMIKVYGYNWEAVGAYNAGLKK
ENYPQRMMYAHKVWKKYQELKLAARD

Enzyme Prediction     

No EC number prediction in MGYG000002823_01768.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	20	140	5.2e-24	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.01e-89	1	146	1	148	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	2.61e-50	27	138	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	3.97e-27	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	2.67e-23	1	141	1	146	lytic transglycosylase; Provisional
COG0741	MltE	5.84e-14	20	117	143	240	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBW26251.1	2.46e-102	1	145	1	145
QCE24518.1	2.46e-102	1	145	1	145
QCE29977.1	1.95e-99	1	145	1	145
AMJ71401.1	2.47e-95	1	144	1	144
QBC03532.1	2.10e-94	1	144	1	144

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.61e-09	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	2.28e-44	4	141	5	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.28e-44	4	141	5	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	9.24e-44	4	141	5	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	2.35e-32	1	144	1	143	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	3.32e-32	1	144	1	143	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001083	0.996783	0.001500	0.000206	0.000196	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002823_01768.