CAZyme Information: MGYG000002825_02046

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_02046
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000002825_7|CGC3	79080.33	8.9661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 187195; End: 189303 Strand: -

Full Sequence      

MKKSLFWLLVLVLAPVAALVVITPMDSQKQYIFGLLSIGILLIMGFSKNRSVSVIMVVTS
LLMSTRYMYFRLTQTLHFNSTIEAILGMGLFLAEVYIWVMLLLNYLQTVWPLKREIVPLP
DDMSTWPTVDIYIPSYNEPLEVVRDTVLAAQCIDYPADKLKIYLLDDGKRSDFAVFAADV
GVGYITRNDNKHAKAGNLNHAMTLTNGELICVFDCDHVATRVFLQATVGGFLNDPMLALV
QTPHYFYSPDPFERNLSVGRNIPNEGMLFYGPIQQGNDNWNATFFCGSCAVIRRTALDQI
GGFAVETVTEDAHTALKFQRLGWKSAFLDIPLAAGLATERLVVHVIQRTRWARGMTQIFR
LDNPLLGRGLTFQQRLCYLSAMLYYQFALPRVVFVTAPLAYLLFNLNIIYSSASLVVSYA
LPHLFLAIYVGSRMNGRYRYSFWGEIYDIVLAFHLVLPTLVTMIFPKRGKFNVTDKGGLL
DVGYFDFTVVRPHLVVAGLLGLGVVVGIVRAVGHDYFGSDPWVIALNVGWGIYSLIFLLA
AIAVARESRQVRKTIRIDVDIPVLIHYTSGIVSRSHTADLSMGGCRVVAPDKRHQQDEIE
AIELLLQSGAIAIPVRQVTGDDRFVRLQFDEHIPLSRRRELVRVVLARADAWINPPRPQD
NPFRSFATILRCVFDLFWLTWKTRSQRRQPPAANPAREDGGL

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	130	300	4.2e-33	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	0.0	1	670	5	695	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	0.0	5	671	137	804	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	2.16e-116	127	359	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.33e-53	90	491	16	393	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.29e-28	131	360	2	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGN40212.1	0.0	1	702	1	703
QLT74091.1	0.0	1	702	1	703
QLO34577.1	0.0	1	702	1	703
QBG05911.1	0.0	1	702	1	703
QFI03682.1	0.0	1	702	1	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.18e-203	16	674	161	820	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	3.86e-105	5	588	6	606	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.20e-104	5	588	18	618	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.25e-104	5	588	19	619	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19449	6.49e-208	25	695	47	730	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
P58931	2.26e-207	20	652	52	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q9WX61	7.79e-207	25	677	47	701	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
P37653	7.79e-203	16	674	161	820	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
O82859	9.20e-203	43	695	65	732	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	25
30	47
52	69
84	106
382	404
408	430
443	465
487	509
522	544