CAZyme Information: MGYG000002825_02147

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_02147
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42381.32	6.8921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 18358; End: 19506 Strand: -

Full Sequence      

MAGQRPLTIALVAGETSGDILGAGLIRALKARVPDARFVGVAGPLMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKQQGIKTIHY
VSPSVWAWRQKRVFKIGRSTDLVLAFLPFEKAFYDKFNVPCRFIGHTMADAMPLDPDKSA
ARDRLGIAREAHCLALLPGSRGAEVEMLSADFLKTAQILRNDYPDLEIVVPLVNVKRREQ
FERIKAQTAPDLAVHLLDGQARDAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFTF
WLAKRLVKTDYVSLPNLLAGRELVKELLQDECQPQALADALKPLLDDSKASHDMHETFRT
LHQQIRCNADEQAADAVLELAK

Enzyme Prediction     

No EC number prediction in MGYG000002825_02147.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	366	3.9e-142	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	380	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	382	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	6	382	1	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	0.0	9	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.60e-50	11	369	231	593	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBG09866.1	4.92e-265	1	382	1	382
QGN36675.1	9.92e-265	1	382	1	382
AUV55018.1	8.14e-264	1	382	1	382
QEU44408.1	8.14e-264	1	382	1	382
ATM07078.1	8.14e-264	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.50e-242	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.23e-241	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6T4Y4	7.04e-257	1	382	1	382	Lipid-A-disaccharide synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=lpxB PE=3 SV=1
B5Y1I9	1.66e-255	1	382	1	382	Lipid-A-disaccharide synthase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=lpxB PE=3 SV=1
B5R421	1.25e-252	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=lpxB PE=3 SV=1
B5RHG7	1.25e-252	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=lpxB PE=3 SV=1
B5FJ29	1.25e-252	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002825_02147.