CAZyme Information: MGYG000002825_02988

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_02988
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		42744.41	4.1024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 37287; End: 38549 Strand: +

Full Sequence      

MSALTFTISLPPLSEGVAQTGNMPEQSQSTAGQSNPETIEQLAQMLGQLLQPLAGSQANN
GSSAPFGNNSDPLGGIGSQGQNGVSPQNASSNQLGTMGSNGLDQSLMSDDQGGGHISDNQ
LLKALLKLIAQMMDGQNGQFGQPNTASQNAGGGSNNSTTDGGSPTNALSSPSSTGLPASG
SVLPSSPVGGTAEPSLMSNLSDPLGSSGTGASSAVGFPDASDNPTVLNNTIIVKAGQEFD
GKGQTFTAGPALGDGGQSESQKPLFKLEDGASLKNVIIGNNGADGIHLYGDAKIDNVHFT
DVGEDAITVKPNSDGKKSNVEITNSSFANATDKILQLNADTSLTVDNVKAKDFGTFLRTN
GGQQGDWDLNLNNISAQNGKYSFVKSDSEGLNVNASNISLDNVNNHYKVPDSARLQVAES

Enzyme Prediction     

No EC number prediction in MGYG000002825_02988.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	225	401	2.8e-73	0.9884393063583815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03211	Pectate_lyase	9.96e-54	216	380	3	163	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWO77487.1	4.03e-200	1	420	1	421
CAO95587.1	1.41e-153	1	419	1	447
AAQ17046.1	3.13e-148	1	419	1	450
AUX71548.1	3.13e-148	1	419	1	450
CAX56846.1	3.13e-148	1	419	1	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	4.82e-40	224	408	2	182	CrystalStructure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	3.57e-38	226	415	9	192	Theliganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	3.67e-38	226	415	10	193	Thecrystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	3.43e-37	226	415	18	201	C.bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	3.43e-37	226	415	18	201	C.bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X6Z2	7.16e-40	213	388	16	187	Pectate lyase A OS=Paenibacillus barcinonensis OX=198119 GN=pelA PE=1 SV=1
D3JTC1	2.74e-39	213	388	16	187	Pectate lyase A OS=Paenibacillus amylolyticus OX=1451 GN=pelA PE=1 SV=1
Q65EF5	5.21e-39	217	397	22	197	Pectate lyase C OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=pelC PE=3 SV=2
O34310	1.48e-37	226	403	31	203	Pectate lyase C OS=Bacillus subtilis (strain 168) OX=224308 GN=pelC PE=1 SV=1
Q0CCF8	2.50e-14	210	361	14	167	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002825_02988.