CAZyme Information: MGYG000002825_03677

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_03677
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000002825_17|CGC1	43580.47	9.7092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 28481; End: 29623 Strand: -

Full Sequence      

MTEKVAVQVSPRKFQKIRELNRRRNYFTKRVRSAVRIHLAKAFWDSRTRHEVDLSSAKTV
LLMRNEGALGDVVVDSALVKCLHEAGMTVDFLLTKSNSQVMRHNPRIRHIYEADNVSSAD
FLRKFTHNVPKSIINELANNKYDIVIDPSLFDIPVHRMLLLRQINAKSVLGFNKWPSINH
YSKSFDFDCEKLHVSKTFDLIADYLKLDKKHLASYDLHIPQDVYQEVGDYMAGREGRKVV
INIFAGNQDRSMSQEQLATLIARLRTDYPDVNIILLDHRNEIRIPLAEKVSVNPFKTLHH
CMALIAQADLVISPDTSVVHMAAAWKKPLVAVYKDVLLNNRLWAPGYDNARQIIVKCGKV
HQMDNLPDLIMSAIDPDLLQ

Enzyme Prediction     

No EC number prediction in MGYG000002825_03677.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	133	349	7.3e-27	0.8533333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.93e-28	59	377	1	269	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.71e-24	58	378	2	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.05e-10	132	333	3	209	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	4.23e-04	303	363	258	314	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	4.86e-04	280	333	223	277	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBG11147.1	1.43e-233	1	379	1	379
QQO30116.1	5.02e-233	1	380	1	380
QUE99074.1	7.14e-233	1	380	1	380
QPF30340.1	7.14e-233	1	380	1	380
QZY82823.1	7.14e-233	1	380	1	380

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	2.63e-26	53	364	36	340	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002825_03677.