CAZyme Information: MGYG000002825_04633

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_04633
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	MGYG000002825_31|CGC1	21336.2	9.2979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 8968; End: 9546 Strand: +

Full Sequence      

MSHGSNPVHPYAIAEILPDSRGVISHFPTSLPEAIRLTRQLATQERRYSVGLMQITSTNF
RHYGVTASDLLNPCINLSVFERILADCYRRGGTLKRALSCYYSGNFETGQRPESAFNRTS
YVQRIGYVVPSTREDRQRDPDRNAQPPVRYPAVVLRGEPAGATAPVLTSLHYPGSVIRGA
IPVIPVIPDEEK

Enzyme Prediction     

No EC number prediction in MGYG000002825_04633.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	5.05e-42	10	125	26	138	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13400	LT_IagB-like	2.55e-11	48	125	31	103	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK13864	PRK13864	7.30e-11	42	115	78	172	type IV secretion system lytic transglycosylase VirB1; Provisional
cd00254	LT-like	1.18e-06	50	125	25	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	7.69e-05	49	104	35	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFH72067.1	4.90e-125	9	192	34	214
AZP33110.1	1.06e-124	9	184	34	209
QXX03507.1	2.83e-124	9	192	34	214
AQL21982.1	9.46e-123	9	192	34	214
QZY81908.1	9.46e-123	9	192	34	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C398	1.73e-16	9	125	31	150	Type IV secretion system protein virB1 OS=Brucella abortus biovar 1 (strain 9-941) OX=262698 GN=virB1 PE=3 SV=1
Q2YIT5	1.73e-16	9	125	31	150	Type IV secretion system protein virB1 OS=Brucella abortus (strain 2308) OX=359391 GN=virB1 PE=3 SV=1
Q8YDZ5	1.73e-16	9	125	31	150	Type IV secretion system protein virB1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) OX=224914 GN=virB1 PE=3 SV=1
Q9RPY4	1.73e-16	9	125	31	150	Type IV secretion system protein virB1 OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=virB1 PE=2 SV=1
P17791	1.67e-07	45	109	87	160	Protein virB1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=virB1 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002825_04633.