CAZyme Information: MGYG000002827_00503

Basic Information

• Species: Phyllobacterium sp900539805
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales_A; Rhizobiaceae_A; Phyllobacterium; Phyllobacterium sp900539805
• CAZyme ID: MGYG000002827_00503
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	MGYG000002827_3|CGC1	68315.78	9.1647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002827	5102924	MAG	Singapore	Asia

• Gene Location: Start: 10840; End: 12684 Strand: -

Full Sequence      

MLHRDIEVALAARLHRAGLAKILIVRAFRDSIAGNTSFIEELYASVRGKDALIGQCIADI
TGLAFEAAPQTTGIFLRSGPDITILPHARIATTLNHDSNALTYIAPTIADIAVVKRHLSS
RKELAGRLSVTTPSGVRELLRAGHQHLLADRAARMIEDSRCEYSAKTVLTGQQGILIGIL
ASCLLLGAFEKQQLSWKGAHVILSLFFLACVLLRLVACKNARGDNPLPLLAINPAELPIY
TVMIALYQEADIVPQLVRAILALNWPRSKLQVLFLCEGDDAATLAALRRQGLPQSFDIIS
VSGYGPRTKPKALNYGLLLSKGAFVVVYDAEDRPHPDQLLEAFQRFQRADEKLGCLQAPL
TVANAHESLVARLFAFEYAAHFQSFLPWLAHRGLVLPLGGSSNHFRSDCLTAIGGWDPHN
VTEDAELGTRLARLGYRTDMIERATIEDAPTEIGIWFRQRTRWFKGWMQTWLVQMRQPFT
LLVQLGILRFVVYHLLAVGMIVSSLLYPVTLLFMLSVTLCWLSGSDVFALHRDILCIDLI
NIVMGYLSFHRLGQRALAGKGMPGRILPWIPLYWLLMSLAAWRALGQLNTRPFLWEKTPH
RPAQSTQETPDRNQ

Enzyme Prediction     

No EC number prediction in MGYG000002827_00503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	240	464	3.4e-34	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	1.33e-132	238	478	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	1.06e-45	201	601	20	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	4.09e-34	242	424	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	8.41e-30	238	463	2	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	4.35e-24	324	515	1	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND51855.1	1.48e-267	1	605	1	605
ATU92795.1	5.78e-239	4	605	4	605
SCD22693.1	4.18e-163	5	602	9	604
QGA57309.1	5.91e-163	5	602	9	604
QTN98220.1	5.91e-163	5	602	9	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	4.02e-08	224	474	115	382	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.18e-08	224	474	127	394	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.18e-08	224	474	128	395	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.79e-19	233	466	44	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8LIY0	1.60e-13	187	469	152	471	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
Q9ZQB9	8.53e-13	233	469	236	479	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1
P74165	1.57e-10	213	472	81	341	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q9LR87	1.18e-08	238	466	122	357	Probable glucomannan 4-beta-mannosyltransferase 10 OS=Arabidopsis thaliana OX=3702 GN=CSLA10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
167	189
199	218
491	513
528	550
563	585