CAZyme Information: MGYG000002827_00710

Basic Information

• Species: Phyllobacterium sp900539805
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales_A; Rhizobiaceae_A; Phyllobacterium; Phyllobacterium sp900539805
• CAZyme ID: MGYG000002827_00710
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	MGYG000002827_3|CGC2	26735.52	8.6678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002827	5102924	MAG	Singapore	Asia

• Gene Location: Start: 230712; End: 231461 Strand: -

Full Sequence      

MSFVANRSSRPAAVDTGRFARTAHRPRRVLIGLCLLGLTVPEAARAVEANDPGMPPVKIT
ASGERTTAPQPAADMAVCQFKRVPSAEDGKALVQRIAREEHADVALAVAVARQESGFRMD
SVSSAGAIGLMQLMPATARRFEVDICDPEDNVRGGVRYLKHLQTKYANPLYVLAAYNAGE
LAVEQSGGIPLYPETVHYVAAVLSDVYDWRPLGDRKVPGKAAHQGRKAPDKPDAGSIGAW
TQGFVLHVE

Enzyme Prediction     

No EC number prediction in MGYG000002827_00710.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	103	204	1.3e-25	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.67e-34	112	204	9	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.45e-32	112	210	29	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.16e-26	112	205	27	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	7.37e-25	113	179	21	95	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.24e-22	112	183	20	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND54690.1	8.06e-77	54	249	1	200
ACI94790.1	4.45e-47	41	249	27	244
AEI08318.1	4.45e-47	41	249	27	244
AEI04689.1	4.45e-47	41	249	27	244
ABE65032.1	7.44e-47	41	249	26	250

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.32e-08	109	185	469	556	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.34e-08	109	185	498	585	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
1QSA_A	2.39e-08	107	227	471	617	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
6FC4_A	3.20e-08	109	185	470	557	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	3.20e-08	109	185	469	556	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.80e-21	93	207	64	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.47e-16	93	205	1426	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.47e-16	93	205	1426	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
Q9CLB8	4.09e-08	92	199	193	330	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2
P44888	9.61e-08	107	218	446	581	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.147575	0.749851	0.026762	0.065133	0.009589	0.001068

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002827_00710.