CAZyme Information: MGYG000002827_02385

Basic Information

• Species: Phyllobacterium sp900539805
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales_A; Rhizobiaceae_A; Phyllobacterium; Phyllobacterium sp900539805
• CAZyme ID: MGYG000002827_02385
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000002827_16|CGC1	29597.83	10.4675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002827	5102924	MAG	Singapore	Asia

• Gene Location: Start: 67188; End: 67994 Strand: +

Full Sequence      

MEMVPFGGWLLYVHGGLSTQAAGVTRVLVRNKRGGGYLVSPGGSPLGRIVRYLILAGILL
MMIPIILLSLYRLPFVHPVSTLMVKDLVTFSGYDRRWVSLDEISPVLVHSVMMSEDARFC
FHSGVDWDAMNLVVSDAMDGEQTRGASTITMQTAKNLFLWNSRSFIRKGLEMPLAMMTDL
ILTKRRVMEIYLNIAEWGPGIYGIEAAAQHHFKVSAARLTPRQAAFLAVTLPNPIARNPA
RPGQGLQTLARLNERRARGAGAYIGCVK

Enzyme Prediction     

No EC number prediction in MGYG000002827_02385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	88	244	3.7e-51	0.8870056497175142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	6.95e-112	43	266	2	232	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
COG0744	MrcB	2.08e-73	31	263	8	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02070	mono_pep_trsgly	2.69e-68	47	261	1	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	2.24e-65	87	258	5	171	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.81e-30	48	241	3	218	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND54035.1	4.27e-161	20	268	2	250
ATU93561.1	4.12e-143	38	268	1	231
ACI57090.1	4.63e-103	48	267	12	231
QSW95169.1	4.92e-103	50	267	26	243
ANM19145.1	6.57e-103	48	267	12	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.64e-21	95	239	20	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.64e-21	95	239	20	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	9.45e-18	85	239	29	184	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.30e-17	92	256	36	196	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	3.39e-16	98	239	42	184	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5ZU97	9.26e-104	48	267	12	231	Biosynthetic peptidoglycan transglycosylase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) OX=395492 GN=mtgA PE=3 SV=1
Q2K330	1.86e-103	49	267	13	231	Biosynthetic peptidoglycan transglycosylase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=mtgA PE=3 SV=1
B3PR74	7.56e-103	50	267	14	231	Biosynthetic peptidoglycan transglycosylase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=mtgA PE=3 SV=1
Q8UBX8	3.42e-102	49	267	6	224	Biosynthetic peptidoglycan transglycosylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mtgA PE=3 SV=2
Q1MAC8	3.76e-101	48	267	24	243	Biosynthetic peptidoglycan transglycosylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999766	0.000248	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
49	71