CAZyme Information: MGYG000002827_03637

Basic Information

• Species: Phyllobacterium sp900539805
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales_A; Rhizobiaceae_A; Phyllobacterium; Phyllobacterium sp900539805
• CAZyme ID: MGYG000002827_03637
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1273		138170.91	6.1353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002827	5102924	MAG	Singapore	Asia

• Gene Location: Start: 427; End: 4248 Strand: +

Full Sequence      

MATLILQGVGAYIGSAVTSLGAYLIDRAFSGTKHIEGSRLAAMKPMTAEEGAALPKVYGS
VRLTGTLIWATRFDEVKSRRRSGAKGGPKVTEYSYVGNFAIALAEGEISLVRRIWADGRE
VDQNALTLRVHKGGASQLPDPLIEAKQGTGNAPAYRNTAYVVFERFPLEMYGNRIPQFQF
EVVRAVGALARDLKAVALIPGATEFGLSPTPVTCEPAPGETRGLNRNCLRGATDWQASLD
ELQALCPSLENIAIVVPWFGTDLRAGHCRIRPGVMDREGYDESEAWRAGDVARDEAHLMS
RSGDCAAYGGTPSDRSVTEAIRAAKARGLKVTLYPFLMLDIAADNTLPDPHGSPRQAAYP
WRGRISCHPAPYRPGSSNGTAAAAAEVTAFLGAAEIRSFGTDEGSVIYHGEGDDWGYRRF
ILHLAHLAVCAGGVDAFLLGSELCGLTGIRGEGDSFPFVSGLCTLAGDVRTVLGSGCLLT
YGADWTEYFGHHPQDGSNDVFFHLDPLWAHPAVGAVGIDNYMPLSDWRDEDYSAPSASGF
SGPYDLAALQSQIAGGEGFDWYYASDADRTARRRTPITDGSGKPWVYRYKDIEAWWKNPH
YNRKGGVESANATAWQPMGKPIWLTELGCPAVDKGANQPNVFPDAKSSEGAFPYFSDHGR
SDLAQNRFLRAHLDHWRSHGGAMLNTGRVYVWAWDTRPFPEFPLNRKLWSDGNNWTSGHW
LNGRLSGVALDELIGAVLADFGVAGVDASAADGFVSGLIVEEPAHARSVLEPLLEVFGIN
AFEDGATLVFQSAARMPVQTALIDEFVEPDDRGPVQRKLHEIMEQPARVEIAYRDPMLDY
QVAMASAGRPDGKGTENLAVAAMLEAGQVKGLAEDWLQARRAARRTISFELPWKHAALKV
GSRIRLDGSMPVKDYLVTSIEDGATRRVEAKGLPRHVRHADRAGLPASTGVATTVFGRPR
FHLCDLPMWPGAENPLDQLRVAAFASPWAGASVHASPEDTGFEARAALPERAVMGRLAET
LPGGVSGRLLGNAGLEVDLDFGELRSTTLPQLFNGSNSVLLASPDGQWEILQFLHAEEVA
AERWRLSGLLRGQCGTEREALQPRERHTPFILLDGAVMPAGLKARETGLALRWRIGAAGQ
DFSDRYFSTVPMTGSIRALEPLEPVHLSGRTDEQGNLHIAWIRRGRIDADSWLAAEIPLG
EEREAYRIEIRNSGKLIRSAEVARPEWLYPAALRLADFGSLASAVDFSVAMISSAAGAGR
FARTIFNMQTKAL

Enzyme Prediction     

No EC number prediction in MGYG000002827_03637.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13547	GTA_TIM	1.65e-174	415	703	1	299	GTA TIM-barrel-like domain. This domain is found in the gene transfer agent protein. An unusual system of genetic exchange exists in the purple nonsulfur bacterium Rhodobacter capsulatus. DNA transmission is mediated by a small bacteriophage-like particle called the gene transfer agent (GTA) that transfers random 4.5-kb segments of the producing cell's genome to recipient cells, where allelic replacement occurs. The genes involved in this process appear to be found widely in bacteria. According to the SUPERFAMILY database this domain has a TIM barrel fold.
cd19607	GTA_TIM-barrel-like	2.52e-149	242	743	1	438	Putative glycoside hydrolase TIM-barrel domain in gene transfer agent and similar proteins. This domain is found in the gene transfer agent protein, such as the Rhodobacter capsulatus putative gene transfer agent protein encoded by orfg15. In the purple nonsulfur bacterium Rhodobacter capsulatus, DNA transmission is mediated via an unusual system, a small bacteriophage-like particle called the gene transfer agent (GTA) that transfers random 4.5-kb segments of the producing cell's genome to recipient cells, where allelic replacement occurs.
cd19606	GH113-like	1.15e-34	252	724	5	293	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.
pfam13550	Phage-tail_3	1.51e-24	762	922	2	164	Putative phage tail protein. This putative domain is found in the large gene transfer agent protein. These produce defective phage like particles. This domain is similar to other phage-tail protein families.
cd19608	GH113_mannanase-like	8.58e-17	227	706	13	293	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVQ37612.1	0.0	1	1266	1	1262
QVQ44756.1	0.0	1	1266	1	1262
QYM72739.1	0.0	1	1266	1	1262
QKW96242.1	0.0	9	1259	20	1257
AYM56667.1	0.0	1	1259	1	1257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TBA_8A	5.66e-280	10	1263	26	1299	Chain8A, Uncharacterized protein [Rhodobacter capsulatus SB 1003],6TBA_8B Chain 8B, Uncharacterized protein [Rhodobacter capsulatus SB 1003],6TBA_8C Chain 8C, Uncharacterized protein [Rhodobacter capsulatus SB 1003],6TEH_D Baseplate of native GTA particle computed with C3 symmetry [Rhodobacter capsulatus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002827_03637.