CAZyme Information: MGYG000002829_04201

Basic Information

• Species: Enterocloster sp900551225
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900551225
• CAZyme ID: MGYG000002829_04201
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000002829_390|CGC1	34195.93	4.8865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002829	5484129	MAG	Singapore	Asia

• Gene Location: Start: 60; End: 974 Strand: -

Full Sequence      

MPTENQSSKSWVLWLKLACISTAIYITWRIFFTIPTENGLLSWAMGIILLLAEATEALEI
FGNYWNAAETVEPELPKVPDSWYPDVDILIATHNEPENLLFKTVNGCKFLTYPDKAKVHI
YLCDDGNRPEIKRLAETMEIGYLGLEGNREAKAGNLNHALSKTNSPLVATFDADMIPTST
FLMETVPYFYIPVTDENKKWKIGFIQTPQSFYNPDLFQFNLYAEQKVPNEQDYFFRHVNV
RRNRTNTPIYAGSNTVISREALNAVGGICTGTVTEDFATGIAIQAAGYTCYATGRPLAHA
MSFS

Enzyme Prediction     

No EC number prediction in MGYG000002829_04201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	87	265	8.2e-18	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	1.18e-80	84	302	1	212	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	2.99e-50	25	298	200	466	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	4.01e-36	43	299	10	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	2.91e-22	93	301	7	209	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06437	CESA_CaSu_A2	8.73e-20	84	290	1	202	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08945.1	1.44e-123	15	302	15	314
ADL34255.1	2.59e-121	5	302	2	313
ALU14736.1	1.41e-116	17	302	16	295
QCT70363.1	3.60e-116	17	302	25	304
AEF82376.1	2.30e-110	20	302	36	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.81e-38	1	289	193	470	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.46e-34	13	288	56	343	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.64e-34	13	288	68	355	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.64e-34	13	288	69	356	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9WX75	2.55e-40	12	298	73	352	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q9RBJ2	2.55e-40	12	298	73	352	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
P0CW87	2.18e-39	4	298	68	355	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
Q76KJ8	2.18e-39	4	298	68	355	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
Q9WX61	2.48e-39	4	302	68	359	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
39	61