CAZyme Information: MGYG000002832_00792

Basic Information

• Species: Prevotella sp900548195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548195
• CAZyme ID: MGYG000002832_00792
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		48632.98	7.4011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002832	2701309	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 13112; End: 14410 Strand: +

Full Sequence      

MKQVITSLFFLLLSLTASAQNGEFVGGDISILPLYETHNTGYRDTKGNNIDDLISWFVSE
CGWNSFRVRLFVDPKEKNQKGETDHCVCQNIDFVKKLGKRIKDAGAYFVLDIHYSDTWAD
PSSQILPTSWSDCTTVAKKADKVYSYTKEVLQTLKDAGAKPDFVQVGNETTYGMIGIKVF
PYDHASNDWTGLTKVFSYGCKAVREVCPDAKIIIHTERSGVPGQTVYYYNKLKDAKVDYD
IIGLSYYPFYHDGLSTLSSTLDRLAAQFSDKKVQIMETSYPFQYYPGDKKYDLQSKWKAS
ADGQYQFTKDLIDLLKKHKNVNALYWWQPEEAGNGDDSDWKTGPGATVMGTWLTRGMWWC
DQKSDGHWPVVSSQGFVGKLLSSFLNTTGINDITAPKPGSDSEAWFTISGIRIDKPTKKG
LYIHSGKVISVK

Enzyme Prediction     

No EC number prediction in MGYG000002832_00792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	351	1.4e-82	0.9181286549707602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	1.29e-72	25	343	2	311	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	7.12e-61	26	346	42	359	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80245.1	2.41e-110	23	430	24	421
QUT66820.1	9.71e-90	2	357	3	345
ADE83762.1	8.15e-86	23	430	24	414
AGB28452.1	1.86e-78	5	429	4	443
VEH14955.1	3.81e-75	23	344	47	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R8L_A	1.07e-37	23	383	23	371	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	7.51e-37	23	383	23	371	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	5.18e-35	26	329	6	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	2.07e-34	26	339	23	328	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
7OSK_A	3.82e-33	23	345	49	369	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.36e-46	25	340	8	327	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	5.61e-41	21	383	50	400	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q65CX5	9.11e-37	23	383	48	396	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
A1D3T4	3.44e-36	2	354	4	355	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q9Y7F8	1.11e-34	26	335	22	324	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000367	0.998790	0.000198	0.000219	0.000197	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002832_00792.