CAZyme Information: MGYG000002832_00915

Basic Information

• Species: Prevotella sp900548195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548195
• CAZyme ID: MGYG000002832_00915
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase BoGH31A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1010		116731.32	6.1744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002832	2701309	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 18503; End: 21535 Strand: +

Full Sequence      

MRRIASKRLLTAAMAIVAMMPAFAINYEKTDRGVTVHVTQTNDKGTSPKLVRLQVMGDRI
IRVSATADKQFADRQSLIIVDMAKQTPYEVTENGDIVCVSTSQLKGYVQTSTGEVWFTDA
NGKLIARDRKGGGKEFTPYQCEQIHADGTPETYKGWSMRQVFENLDDKEALYGLGQHQAD
EWNYKGKNEELFQYNTKVSIPFIVSSNNYGILLDNYSLSRFGNPKDYSQLHKAFTLRDKD
GKIGALTGTYSAPGQETLVRREDSIYFENLKSAKNLPKYPLEKATVIYEGTITPHKTGVY
QFCHYYSGYQKIYIGGLSAYTEDVAGKGDNNQEIWRTAWNPNARKFDFKLEEGKTYTIRI
EWKPDGSEAYCGLRALEPVDENEQRQISFWSEMGQQLDYYFMTGDNADEVISGYRTLTGK
AQIMPLWLFGYWQSRERYKTQDEIVDALNGFRQRQLPIDNIVMDWNYWTPDSWGAFTFDP
SRFSSPKKMIDDIHAQNAKIMISCWPKYYLTVDNFHELNDKGMIYQQSIKDSLYDWLGYK
YAFYDAYDEDARKIFWRQLYEKLGTIGMDAWWMDASEPNVRDCTDMEYRKLLCGPTKYGS
SDEYFNAYSIVNAEAIYDGQRGYETEIEKQGEGNMPDSKWLEKNTNWDQRGFGNSFSPNN
KRVFLLTRNGFASEQRYSTATWSGDIGTRWEDMKAQITAGLNFSISGVPYWSQDIGGFSV
EKRYAEAQEEFDKTGKENEDLKEWRELNARWHQLGMFAPMYRSHGQFPFREPWNIAPEGH
PAYRVISDCLQLRYRLMPYIYSIAADVHFKDYTMMRPLVMDFGKDEKALDVAYQFMFGPS
IMVNPVYRYGQRTCDVYFPKDNIWYDFYTGKLLSHGDQRLRLQAPYERIPLCVRAGSIIP
VGPALEYVSQHKADVIRLFVYQGKDGSFNLYEDEGDNYGYEAGRYSNINISYNEVEKTVT
IGERKGEFPGMLHKRTFIIVPVSANKAQGYDPEAKGIVVKYDGKKVTKRI

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	399	899	2.6e-132	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	1.98e-158	400	899	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	1.08e-143	387	988	225	760	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	9.42e-139	419	793	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
cd06603	GH31_GANC_GANAB_alpha	6.63e-67	419	900	1	427	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06598	GH31_transferase_CtsZ	1.74e-58	419	804	1	330	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99682.1	0.0	27	1010	24	952
QGT72479.1	0.0	27	1010	24	952
ALJ47674.1	0.0	27	1010	24	952
SCV07072.1	0.0	27	1010	26	954
QRQ54579.1	0.0	27	1010	26	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JOU_A	0.0	21	1010	21	955	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	7.27e-260	2	1007	36	974	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	7.25e-254	28	1007	50	983	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	4.26e-57	388	986	228	780	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	4.55e-56	388	986	228	780	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT0	0.0	27	1010	26	954	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9P999	3.37e-130	51	1004	8	723	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9F234	8.92e-63	390	961	223	737	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q8BHN3	1.83e-46	373	942	339	856	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
Q14697	2.42e-46	376	942	342	856	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000422	0.998756	0.000245	0.000190	0.000186	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002832_00915.