CAZyme Information: MGYG000002832_01080

Basic Information

• Species: Prevotella sp900548195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548195
• CAZyme ID: MGYG000002832_01080
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000002832_51|CGC1	36207.33	8.2124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002832	2701309	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 9490; End: 10452 Strand: +

Full Sequence      

MKKLTIIIISIMSVIGMNAQVSDNPDTLVVARDGTGQFRNIDEALEVCRAFMEYHKVIYV
KKGVYKEKLILPSWLTNVEICGEDRDNTIITYDDHANIKSDQIHSKSQKIGTFRTYTLRI
DGSDITIKNITIENNAPRLGQAVALHTEGNRIKFLNCRFLGNQDTIYTGRGETKLLFKDC
YIEGTTDFIFGPSTAWFENCDIFCKANSYITAASTPQNVQYGYVFNNCHITLAPEVTKMC
LGRPWRSFAHTVFMNCDLPKGIAPGGWNDWKKDTNLVRYAEYNNRGEGANTDKRVAWAKQ
LTKKDAKQLTIANVLGTWAE

Enzyme Prediction     

No EC number prediction in MGYG000002832_01080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	315	5.2e-96	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	5.81e-73	29	316	3	296	Pectinesterase.
PLN02773	PLN02773	6.26e-70	28	309	7	290	pectinesterase
PLN02990	PLN02990	7.26e-58	29	318	262	559	Probable pectinesterase/pectinesterase inhibitor
COG4677	PemB	4.29e-56	21	318	76	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	2.96e-55	27	307	70	353	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR97878.1	8.23e-152	16	314	10	309
QVJ81978.1	6.96e-147	1	310	1	309
ADE82952.1	6.96e-147	1	310	1	309
BCS84477.1	1.27e-145	1	314	1	314
ALA73615.1	8.03e-137	1	317	1	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.79e-37	29	318	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	7.30e-36	28	297	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	9.19e-36	28	320	11	296	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.91e-35	28	320	11	296	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.46e-29	57	318	36	337	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	1.11e-50	27	315	272	567	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9LVQ0	1.06e-49	30	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FJ21	2.48e-49	28	315	260	553	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8GXA1	1.24e-48	29	306	259	542	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q42608	1.80e-48	27	315	259	554	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999104	0.000190	0.000153	0.000148	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002832_01080.