CAZyme Information: MGYG000002832_01647

Basic Information

• Species: Prevotella sp900548195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548195
• CAZyme ID: MGYG000002832_01647
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1358		153284.1	8.0141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002832	2701309	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 5413; End: 9489 Strand: +

Full Sequence      

MHRLLTTLILSIIHLSIFSTVRVTHLSIEGRQDCPLGIDVKAPSLGWRLTTDDGSYHVSQ
TRYHILVASSELLLSQDKGDIWDHTTVSDQSQWIPFCGKKLSPNAKYWWKVRAEYSYSSS
IDGKKTKKAWTEWSAPSSWSMGLMHEYRWKGYWIGMEHANPWDREDEHSRLSARYFRRTF
PLASEVKRATLHICGLGLYEAYIDGSLISKDTKNDLSRLGDIVMTPAPTDYRKSIIYNTF
DITPLLQNDRSKHCIAVTVSNGRFYTMQQNKKKHKITNFGYPCLRANLIIEYNNGKTETI
ATDDKLWRLNADGAIRSANEYDGEIYDARKQFGGSAKAWTSPDFDDSSWQLAQRSAIPSG
SLIGNLTPPMRILDTLRVKHSSTIGNAIVMDFGQNYAGWTRINTAACRLSKGDTLRIRYA
ERLNADGSLYTANLRHAQSTDFYIADGKTDSWWAPRFTTHGGRYIEVSVIGKSCPQLSAD
DVIGEVVSDDMTRKGQFSCGNMTLNRLMQNAYWGILSNYKGMPIDCPQRDERQPWLGDRT
MGCWGESFLLDNGALYLKWIKDITEAQRSDGCIPDVAPAYWNYYSDNVTWPTVIITAAEM
LYRQYGDTRAIEAYYPQMMKWFSHIWEDKRDSKTGLVKADKYGDWCVTPESPSLIHSQDP
GRKTDGMLIGSAYMFHLANIMKSFASILMEKTATDGMEMERRGMSRNVLAADTLLYNSVR
SKLRKAINDHFLVVKPGTSAVTLYAPDCAPQHMLYPDSIYYANNSLTANLLPLAFGIVPE
QYEEVITNQILSRLLLNPANGHLCCGVIGVQWLLTELSRRHRTDVAYLLASRKDFPSWGF
MAEQGATTIWELWNGDTANPAMNSGNHVMLLGDLVPWMFRDLGGIAPAEAGYKRIRLAPR
FELEELSQATASYECPYGMIKSSWQKTLDHLHWEITIPCNTVAEVQMPHKVLTLGSGHYV
FDESLPLSSVPADKQKGSDMQVKANEFLYEKAEFPSCHACTIAELTNGDLLAAYFGGSYE
SCPDVCIYTQRKRLIKRDAKHGNVYEAGWSAPVKVADGIMNDSLRKACYNPVLFQIPGGD
LLLHYKIGKDVRDWTGYQMRSTDNGYTWSSQRDSIPAVAGVCPDSLLGAIKNQPIFLPKG
FRCKNGTVLTTSRIIAPTSKETAFASKVKPGQWRCYMEISEDDGRSWTITPQVPQNNNLF
RTIQPTVLIHRDGRLQLLARTAPPKHPAQKENARVATSWSDDGGLTWSEMEFVKDLPNNN
SGIDAVTLPDGSFAIIYNPFGCVDWKKKTEADRNKPLRNPLWVATSPDGIHWTPQLSLES
SPISQYSYPSMIVGSDGSLHCIYTWRRQRVKYQRIGLQ

Enzyme Prediction     

No EC number prediction in MGYG000002832_01647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	386	946	5.3e-141	0.9841269841269841
CBM67	162	354	1.9e-27	0.9204545454545454
GH33	985	1343	1.8e-26	0.9239766081871345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.24e-102	493	880	2	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam13088	BNR_2	2.26e-78	1008	1341	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam08531	Bac_rhamnosid_N	9.32e-55	185	372	2	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
cd15482	Sialidase_non-viral	2.49e-44	987	1355	4	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam05592	Bac_rhamnosid	1.97e-27	389	488	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95828.1	0.0	16	1355	19	1283
QNL37629.1	0.0	16	1355	19	1283
QGT69954.1	0.0	16	1357	17	1283
QDH55645.1	0.0	16	1355	17	1281
CBK65853.1	0.0	16	1355	17	1281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.71e-144	35	948	43	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.88e-102	19	948	2	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.71e-75	36	957	16	859	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.52e-113	25	948	37	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	2.55e-101	19	948	2	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	6.87e-92	35	990	43	909	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.46e-90	35	945	43	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KM26	9.92e-13	583	947	797	1136	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.096873	0.900993	0.000980	0.000357	0.000334	0.000416

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002832_01647.