CAZyme Information: MGYG000002832_01742

Basic Information

• Species: Prevotella sp900548195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548195
• CAZyme ID: MGYG000002832_01742
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000002832_117|CGC1	71304.48	5.943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002832	2701309	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 2484; End: 4367 Strand: -

Full Sequence      

MIYKSIAMITLGLAMLSLDSVAQTTRGAYKDIVDISLTPGAPRRQNGCFTDMGSWMGFTL
SEKENPTTGFCGPFSIYYRNWYARSLVSLTGATLIEHSYYPGEVRMSLQKDGGEIRESLQ
FVDARTALLTVTNPSKLPLTFTGDSISSKLNVTLKGNAVIIGDLYSERIMLTFPKQVKLE
VSNHNYVAQLPAGVSHFTAAISIVEQDTEESVQNVHTASLLANPSAALEANESRWNGYLQ
KVIRDDMPADYNRVATKSIVTLLSNWRTKRGNLYHDGIVPSHAVGYFVGCWAWDCWRFSA
GMASFFPELAKDNIRVMFDYQQPDGMIIDCIYPDASENNARDSKPPLAAWAVNEIYEHNN
DLAFVKEMYPKLLKYHKWWYEKRDHDKNHICEFGSTDGTLEAAAWESGMDNAIRFDDTKM
LKNDAENAWSTDQESVDLNAYLSLEYTLLKKFAELLGEPFDLPDYRNLVADYFFDKKDGF
FYDRRLNENRDFVREAGCEGYIPFWANIATPKQFAMARKLFDNKKKFSTYIPFPTIAADN
PKFDPKGYWRGPIWLDQTYYGIKGYRNYGENKKADAYTDQVFRNLEGISAGTPIHENYDT
HTGKPLKASHFSWSAACLLMLYNDYGK

Enzyme Prediction     

No EC number prediction in MGYG000002832_01742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	175	625	1.1e-106	0.5789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.21e-134	4	625	3	783	alpha-glucosidase; Provisional
COG3408	GDB1	1.29e-17	276	622	270	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.03e-06	343	527	178	402	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	1.11e-06	362	621	185	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	3.78e-04	338	511	193	422	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67704.1	0.0	4	627	4	626
QUT89313.1	1.76e-256	26	627	32	642
ALJ59646.1	1.90e-253	26	627	32	642
QJR62245.1	8.25e-253	19	627	27	644
QJR74523.1	8.25e-253	19	627	27	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.06e-80	49	625	32	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	5.51e-80	49	625	32	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	7.66e-80	49	625	32	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	2.12e-77	49	625	33	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	5.86e-34	402	625	42	305	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	8.86e-80	49	625	55	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.74e-19	283	622	90	486	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.08e-19	283	624	90	488	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	1.75e-08	291	619	40	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000232	0.999122	0.000167	0.000169	0.000148	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002832_01742.