CAZyme Information: MGYG000002834_00186

Basic Information

• Species: Prevotella sp900551985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900551985
• CAZyme ID: MGYG000002834_00186
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		43235.23	8.8352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002834	3427886	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 109; End: 1236 Strand: -

Full Sequence      

MKKLIFSSLFMLLGLTSVSAQNALQNEILEVANRTNNYFMTKYSDPTLDTFVKKVRTSNL
WTRAVYYEGLMALYEIDPQQRYLDYTDKWADYHKWTARGSVNDTDADNQCCQQTYMDRYV
QTGGKKDLSKVKENLDHQMATNRVNYWTWIDAIQMAMPVYAKYAKITGERKYLDYAMNSY
KWSRDTLANGLFNKKEGLWWRDKDYVPPYKEKDGSNCYWSRGNGWVYAALIRVMETLPKT
DKYYQYLKKDFILMSQAILKCQREDGYWNVSLVCPANYGGPEMTGTGLFLYGMAWGVQQG
ILPRATYQKAMDKAWKALAASVHEDGFIGYNQGTGKDPAASQPVTFTSVPDFEDYGTGCL
LLGAAEYYKLVKAKK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	369	1.8e-75	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.58e-84	31	370	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.94e-47	39	370	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85005.1	1.88e-183	1	370	1	365
QVJ80547.1	1.05e-175	1	372	1	387
AGB29883.1	1.23e-171	17	372	14	371
QRQ55827.1	5.24e-142	3	370	4	375
ALJ49019.1	5.61e-142	3	370	6	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.27e-61	27	373	32	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.93e-57	27	372	15	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.25e-41	61	370	53	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.78e-45	61	370	58	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	7.91e-41	61	370	60	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.15e-40	147	366	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000532	0.998572	0.000250	0.000217	0.000205	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002834_00186.