CAZyme Information: MGYG000002835_00006

Basic Information

• Species: Fusicatenibacter sp900543115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter sp900543115
• CAZyme ID: MGYG000002835_00006
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000002835_1|CGC1	36167.59	8.2034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002835	2863124	MAG	United States	North America

• Gene Location: Start: 6977; End: 7921 Strand: -

Full Sequence      

MNKPIVDILIPTYRPGQEFEELLLGLLKQTYPVRNILIVNTNASLWDSRFEQIVPNLYVD
HVEQRQFDHGGTRAAMADASDADLLLFMTQDAIPADEMLVEHLVMQFSLPQVKAAYARQL
PKPGCSTLEAYTRGFNYPPESDIKDYGDLPKLGLKTFFCSNVCAMYDRKVYEELGGFVSH
TIFNEDMIYAAGLIEAGYSIAYAADAQVYHSHNYGCIAQLKRNFDLGVSQAQYPEIFEKY
PSEGEGIRMVRQTAAYVCRIQRPWLLVPLFFQSGFKYLGYLLGKNYQRLPRGVIRHCTMN
RNWWKFPARKRRKR

Enzyme Prediction     

No EC number prediction in MGYG000002835_00006.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	1.11e-04	4	212	2	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04186	GT_2_like_c	1.46e-04	150	212	103	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	1.73e-04	4	209	54	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	0.004	8	210	7	219	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02525	Succinoglycan_BP_ExoA	0.010	164	210	161	207	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV20105.1	2.94e-138	6	305	6	305
QNM10252.1	1.22e-129	6	305	6	305
QBE96877.1	3.63e-127	1	304	1	304
QMW79879.1	3.63e-127	1	304	1	304
QIB57343.1	3.63e-127	1	304	1	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	8.65e-63	6	304	3	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1
Q9WX61	2.18e-06	4	202	149	349	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002835_00006.