CAZyme Information: MGYG000002836_00621

Basic Information

• Species: Anaerocolumna aminovalerica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerocolumna; Anaerocolumna aminovalerica
• CAZyme ID: MGYG000002836_00621
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000002836_3|CGC1	88099.61	5.1294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002836	4582914	MAG	United States	North America

• Gene Location: Start: 152463; End: 154811 Strand: +

Full Sequence      

MNQIDNIMKKLTLEEKVSLCSGIGLWQTKDIEDKRIPAIWMADGSNGIRIMKPVHNQRKQ
DTSEFLQVTDLTQNSPTITKQYEAVCYPSGAALASTWNMELIESMGAMLGDECNFRKVNI
LLAPGINIKRSPLGGRGYEYYSEDPYLTGKTAEAFIKGVQSQGVGTSIKHFAANNAETLR
INMSSDVDERALREIYLAPFELAIKNAKPWTVMSSYNKVNGVQMAENRRLLTDILRDEWN
FDGVVVSDWGGIKDRVQALKAGNDLDMPENRRNNKSIQEAVENGTLDESVLDVSVRRILE
MIFKAKAQERFKDSIDWESHREIAKKVAEDSIILLKNENSLLPITKEKYKKVAVIGAFAT
EPRYQGGGCTLVNPTRISNPYDEICRLAGNDIKITYAKGYEINNRINDQLLTEAVEKAGE
ADAAVIFAGLWVAYDREGFDRKTLDIDSSHIRLIQEICKIQKRVIVVLNNGDAVTMDPWI
NGAGAVVEQFLVGETVGEAVADILFGIVNPSGKLPVSFPKRLEDTSAYPLFPGECNHHIY
GESIFVGYRYYEKKKIDTLFPFGFGLSYTEFAYSNLKLDKTVMNDIQKLTVQVTVANTGS
CKGKEVVQLYVSDKESRLLRPIKELKKFEKIELEQGESKTVTFELSYRDFAYYDPEAEDW
VVEDGIFDIHIGKSCEDIVLTASVEMKDAKKKFRYLYLDSQHARVFENTVSKKMYLDFLV
EKGVLTKDNVDAMVPLLKGNYMGIYNVITSLLGGDITKEEMQEKLDEINQVCTAKSKAES
CF

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	268	6.5e-70	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.51e-110	4	672	38	751	beta-glucosidase BglX.
COG1472	BglX	7.76e-77	11	384	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.94e-66	332	548	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	5.33e-59	123	643	155	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.54e-48	87	301	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACI19278.1	7.77e-237	4	769	38	781
AEV68815.1	9.64e-234	4	693	5	678
BAX82576.1	1.05e-232	2	691	30	700
ACK41548.1	5.62e-231	4	769	5	748
ACK41612.1	4.32e-230	4	721	5	698

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.06e-220	4	771	5	754	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.58e-178	11	686	12	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.90e-133	1	691	1	718	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.91e-132	1	691	1	718	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.89e-121	4	679	6	829	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.13e-219	4	771	5	754	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.32e-176	8	687	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	7.29e-175	8	767	9	751	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.53e-135	3	685	45	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	2.51e-128	4	686	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002836_00621.