CAZyme Information: MGYG000002836_01491

Basic Information

• Species: Anaerocolumna aminovalerica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerocolumna; Anaerocolumna aminovalerica
• CAZyme ID: MGYG000002836_01491
• CAZy Family: CBM12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002836_8|CGC2	35746.14	8.0718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002836	4582914	MAG	United States	North America

• Gene Location: Start: 115604; End: 116602 Strand: -

Full Sequence      

MTNKKFSFKALSLMIILTLFISTFCVALPVSAAARGAWAPNTAYAVNDTVTYSGSTYTCR
QAHTSLQGWEPSNVPALWEKGGSGTTPPITSGVTFYADINYGGTAITLGVGNYTLSQLNA
KGIPNDWMSSLKVPSGWTVEVYEHDNFGGTKWTYTSSSSWVGSAVNDKMSSVKIYIGSPA
PSVTKPSEVPSNIWTYTINVDNKFGKGGDFALLLCAVIKKESSFGAGLPGSPSAGDGLMQ
VEPNTRNAYLSQFSSKFGRTYNHSSEQDQVCMGAMILDEKIIKFGNIYNGLLHYNGGDYW
YPGATDSYGRPILANQYADAVYATYKGYGGKN

Enzyme Prediction     

EC	3.2.1.14

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd12214	ChiA1_BD	3.67e-17	37	80	1	44	chitin-binding domain of Chi A1-like proteins. This group contains proteins related to the chitin binding domain of chitinase A1 (ChiA1) of Bacillus circulans WL-12. Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal and catalytic domain, and 2 fibronectin type III-like domains. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiAi chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)).
smart00247	XTALbg	5.27e-07	93	173	2	80	Beta/gamma crystallins. Beta/gamma crystallins
smart00495	ChtBD3	2.49e-05	37	78	3	41	Chitin-binding domain type 3.
cd00036	ChtBD3	7.91e-05	37	78	1	38	Chitin/cellulose binding domains of chitinase and related enzymes. This group contains proteins related to the cellulose-binding domain of Erwinia chrysanthemi endoglucanase Z (EGZ) and Serratia marcescens chitinase B (ChiB). Gram negative plant parasite Erwinia chrysanthemi produces a variety of depolymerizing enzymes to metabolize pectin and cellulose on the host plant. Cellulase EGZ has a modular structure, with an N-terminal catalytic domain linked to a C-terminal cellulose-binding domain (CBD). CBD mediates the secretion activity of EGZ. Chitinases allow certain bacteria to utilize chitin as a energy source. Typically, non-plant chitinases are of the glycosidase family 18. Bacillus circulans Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal catalytic domain, and 2 fibronectin type III-like domains. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiA1 chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)). Streptomyces griseus Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. ChiC contains the characteristic chitin-binding aromatic residues. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source.
cd13400	LT_IagB-like	9.30e-05	212	326	6	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ95495.1	2.39e-216	1	331	1	336
QOT08501.1	3.22e-212	1	332	1	338
ACX63296.1	9.23e-212	1	332	1	338
AWP29474.1	7.57e-211	1	332	1	338
AVV54832.1	7.57e-211	1	332	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6B_A	4.29e-87	178	331	27	180	Crystalstructure of catalytic domain of chitinase from Ralstonia sp. A-471 [Ralstonia sp. A-471],3W6B_B Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 [Ralstonia sp. A-471],3W6B_C Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 [Ralstonia sp. A-471],3W6B_D Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 [Ralstonia sp. A-471],3W6C_A Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 in complex with disaccharide [Ralstonia sp. A-471],3W6C_B Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 in complex with disaccharide [Ralstonia sp. A-471],3W6C_C Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 in complex with disaccharide [Ralstonia sp. A-471],3W6C_D Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 in complex with disaccharide [Ralstonia sp. A-471]
3W6E_A	1.22e-86	178	331	27	180	Crystalstructure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) [Ralstonia sp. A-471],3W6E_B Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) [Ralstonia sp. A-471],3W6E_C Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) [Ralstonia sp. A-471],3W6E_D Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) [Ralstonia sp. A-471],3W6F_A Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) in complex with disaccharide [Ralstonia sp. A-471],3W6F_B Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) in complex with disaccharide [Ralstonia sp. A-471],3W6F_C Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) in complex with disaccharide [Ralstonia sp. A-471],3W6F_D Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E162Q) in complex with disaccharide [Ralstonia sp. A-471]
3W6D_A	1.22e-86	178	331	27	180	Crystalstructure of catalytic domain of chitinase from Ralstonia sp. A-471 (E141Q) in complex with tetrasaccharide [Ralstonia sp. A-471],3W6D_B Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E141Q) in complex with tetrasaccharide [Ralstonia sp. A-471],3W6D_C Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E141Q) in complex with tetrasaccharide [Ralstonia sp. A-471],3W6D_D Crystal structure of catalytic domain of chitinase from Ralstonia sp. A-471 (E141Q) in complex with tetrasaccharide [Ralstonia sp. A-471]
3SO1_A	1.83e-41	90	175	3	88	Crystalstructure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_B Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_C Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_D Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_E Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_F Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_G Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO1_H Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052]
3SO0_A	5.12e-41	90	175	3	88	Crystalstructure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_B Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_C Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_D Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_E Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_F Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_G Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052],3SO0_H Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	4.54e-11	37	79	655	697	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P52320	2.69e-10	36	80	412	456	Streptogrisin-C OS=Streptomyces griseus OX=1911 GN=sprC PE=3 SV=1
P27050	2.24e-09	34	85	30	81	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
P02966	7.68e-07	93	174	4	84	Development-specific protein S OS=Myxococcus xanthus OX=34 GN=tps PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003172	0.800383	0.195460	0.000550	0.000234	0.000184

TMHMM  Annotations     

start	end
12	34