CAZyme Information: MGYG000002836_03241

Basic Information

• Species: Anaerocolumna aminovalerica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerocolumna; Anaerocolumna aminovalerica
• CAZyme ID: MGYG000002836_03241
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1871	MGYG000002836_32|CGC1	207188.36	5.2756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002836	4582914	MAG	United States	North America

• Gene Location: Start: 35122; End: 40737 Strand: +

Full Sequence      

MKQKMRVKVISFMMAFILVVQTFMGSSGLIIAKASSAPGLEEGISQQNLQNLNGINVASG
SAIDVKANQWQIPDYGTGFTVDPETGMTIIQSEDDHDYYRDNYWNTLDKNKLPGTTVLAS
EEVNVVSGSSIGADGVWHGAKLDDTNFISGIKLNQDVSAQKSYFAFDDQMACFGTGISNI
SEDPTRDVHTIIDNIKFDENAKDKLVLRYSTKTISAWINSTFCPLGNTYTYMDNPGNLSS
NKHWALSLPNGSTVGTGYYFKPNEKDLNFRFVENTDEFNNKKTYLELWLNHGISKNASYS
YYIFKNLKASEGAGALRDYMDKNIAATIANTKDVQAAYYKETNTVSANIWTEKGAAVEYS
AIDNFTVNSQASVMMRKQAGILEAAIAEPTGMSQGTIEVVIDTNGYEVVAKDENISIDLT
TPGKIKLSIDATGKNGETSKVSINTIPPALDGNLSEFSIVKGKSALIPTPEGFEGPVTWT
SIFKNVNGQPIKNVGSSKIKEELKPGETDGNRKEGITSTSHIASMEGIAEGGLFSAKEKG
TVYVIAEDKNGQKREWKVNIAFTESENLPVVEPQDYKALREKWIGLLVGKNIDKNDPATM
AAVEKINSQAQEIWNRYSYKNQPQCGGIPWKDEEGATGNPNIEYQRDAVEFRSAFKNVLV
MAKAYQVEHGALYHNKEMLEDMIHILDWLTTNCYNPQSETDNWWTWEIGIPKDLTPTLIL
LSNELTPEQIAKYTEGILFFQPDPFHGGAIGTASTHVEGYRMQYAANRVDNSITAMGLGL
LLEDNEQMYLAQLASSSVLEFQKVEDSTLLAKNGFENGFYADGSYIDHQNIPYAGSYGIV
VLDGIANVSSVLGNSPWQYDQEKSDILKTILLNTYGIGVYNGLMLDMFRGRAVARDNVTD
QTIGWQVINNAILSLDSVEGQEKQELQNYIKNWVSSNSGYLDSLTELNQLSIKQKAQAII
NDAKITGNIPAVHQNYPLMDRAVHRTSNWLFGVSMFSERINNTEIMNGENLYGWHQGDGM
TYLYNKDFSHYTDNFWNTVNPFRLPGTTTVSKNIGNGEKDSSGFYQKGDYVSKEDWVGGS
MLSNYGVNGMSLSGDVVSEEIYEPNLRALKSYFMFGDQIVCLGTGIHDVDSQYNVETTVE
NRKLKADGSNKITVNGNKLELPIIDVKVSDIVKENGLGTGTASMEGKDLAGDEWIHMEGN
TAGSDIGWYFPSGNQNLKVRKVASTGNWNNINITESGDVVSNYFELWFDHGKNPQNEEYS
YVMLPGRSENEIKEYAKAPSIEILANNSDVQAVYYKGDKVTGANFWNDKEVTVGYITSNK
KASVIVKEDKDLLEIGVSDPTMKNTGTIEIDLDKELDQIISRDENVTVSYVDQKLHISVD
TDKTNGSTSYAVVKIKNEDGSNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNG
NNGNSNNGNSTTKKSETVDRVNNQVIMTTVTSGRDEHNNQVDWVEETIKSLETGEVIKVR
KKVNLVDAKTGEKVETELVKDAKGNILKAAVSTNTESITKEVNKKKAVITAKFSHRNILW
AIAETSKDETGNIVYEAKLLLPIDKLIKELKKSTIKEFELNIELAKELMNASDVTISNID
VSKELIQAAKEKSANISLFVKNPNNDKLYSLSIYGKDLKKSNKKITDINLALKTFKANEL
KPLYKALTGERNKPEGIVIRFEHEGELPALATIKLYNNQKIKYPKGQKLHLYHYNDEAAK
FYELYYNECNVVDKQTIELKIQHCSDYVILPQTLSNKVVVSLLDQVSVPSKVNTEIGKKK
KLMVNSTENAKVSYESSNKNIVTVDKTGTVVGKKQGKAIVKIKVSIKGKERVLKTEVKVL
KTSNEKILKNK

Enzyme Prediction     

No EC number prediction in MGYG000002836_03241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	974	1269	1.7e-81	0.9884169884169884
PL8	85	306	6e-28	0.806949806949807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	0.0	575	1340	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.40e-85	973	1268	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.83e-71	583	931	1	322	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
cd01083	GAG_Lyase	2.79e-28	86	389	411	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	8.62e-22	86	304	47	248	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET74231.1	2.70e-316	104	1395	71	1354
ASM70662.1	1.96e-295	456	1395	74	1010
ASM68536.1	2.69e-248	454	1355	10	906
QPW61069.1	5.17e-172	509	1391	74	921
AEB76773.1	1.71e-170	509	1391	14	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	4.02e-123	575	1402	5	758	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
1J0M_A	8.66e-113	575	1391	3	747	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]
2E24_A	5.53e-112	575	1391	3	747	ChainA, Xanthan lyase [Bacillus sp. GL1]
2E22_A	5.53e-112	575	1391	3	747	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
1X1H_A	1.40e-111	575	1391	3	747	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	2.14e-109	575	1391	28	772	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	8.85e-77	571	1347	44	775	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q53591	7.37e-70	330	1350	11	984	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q54873	2.27e-65	589	1346	273	998	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
P0CZ01	6.88e-44	573	1381	36	784	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.998970	0.000175	0.000183	0.000147	0.000140

TMHMM  Annotations     

start	end
9	31