CAZyme Information: MGYG000002838_00118

Basic Information

• Species: Mediterraneibacter sp900541505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900541505
• CAZyme ID: MGYG000002838_00118
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	MGYG000002838_1|CGC1	78074.85	8.5452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002838	3567810	MAG	United States	North America

• Gene Location: Start: 116414; End: 118444 Strand: -

Full Sequence      

MNLQKVQNYEKKRNLVFVLTILFSTIYLLWRIFFTLPWSAGTLQMAAGIVLVMAETSTTL
GLFELLISRMRSGNYTLHPPKLTKKEFPHVDVLIATHNEPEDLLYKTINACTFLEYPDRD
KVHIYVCDDGNREEIRRLAEHLKVGYLGLKDNVHAKSGNYNNAIEKTDSPLIATFDADMI
PRREFLIKTVPYFFIPGVRMGLVQTPQSFYNQDLFQFNLFAERDIPNEQDFFSREINVMR
NSTNTAAYTGSNTLLSRGAMEEIGGFPYGTITEDFETSLRMQKAGYVTYATSEVLASGLS
ATTVGSMIGQRIRWARGVIQSIQNTNAVFTGKLSLSGRLSYLNAYLYWWSFFNRMVFILS
PILFALFDFQLVQCGFGELLLFWLPSNLLSNRSMKYLSTNVRNLRWSQIIDTILAPYMIL
PVFLETFGIHQKKFKVTEKRKTSVKTTSARYIFPHAVLIVLTLTAIVRYAAGKYGMALLY
SSVILFWLFYNLTALVYAVFFMLGRDSKRKHERIEAEEEIEIRVRKEMYHGRTLDVSEEG
VSFRIFAEGGVEMQMSSEEVSQRSAQTAEELLKKKEQGTEEEPILSSGECFYAVVRTQVY
RANLEGRLVYGKREEAGFFYAAVVRPETEEDFKNWLQIIHDRAHSLPKEIDPWMTAYDDV
VRNISYRYQNRRKEEK

Enzyme Prediction     

No EC number prediction in MGYG000002838_00118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	89	317	2.3e-25	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	5.85e-92	88	320	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	2.14e-84	15	499	188	673	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	2.84e-49	42	496	8	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	7.23e-35	97	320	7	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13641	Glyco_tranf_2_3	1.35e-23	88	317	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN12766.1	8.04e-249	11	676	3	640
QIB68972.1	1.83e-247	10	667	15	659
SMF90406.1	3.28e-247	10	676	4	659
QNK55597.1	1.39e-242	10	667	4	657
APO43063.1	2.66e-241	6	676	12	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	4.50e-62	18	515	204	702	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	3.23e-52	27	454	68	507	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	6.74e-52	27	454	80	519	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	6.80e-52	27	454	81	520	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q93IN2	5.53e-64	18	515	204	702	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	1.04e-63	18	515	204	702	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q8X5L7	8.35e-62	18	515	204	702	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	2.14e-61	18	515	204	702	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q9WX61	2.01e-56	10	545	70	611	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
45	67
345	367
407	429
450	472
482	504