CAZyme Information: MGYG000002838_02459

Basic Information

• Species: Mediterraneibacter sp900541505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900541505
• CAZyme ID: MGYG000002838_02459
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	MGYG000002838_30|CGC1	25278.13	4.7614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002838	3567810	MAG	United States	North America

• Gene Location: Start: 11293; End: 11952 Strand: -

Full Sequence      

MIKRLCSFLLLCALIIAAYFVWQGYQGYREALDEKSVEEMVREIEAKENYTTLDEMPLDY
KNAVLAVEDKRFYKHPGIDPIAIGRALVHDIQAGAYVEGGSTITQQLAKNQFFTQDKKIV
RKISEMFMAFRIERTLDKDKILELYLNSIYFGNGYYCVMDASLGYFGKYPWEMDFDESTL
LAGIPNAPNDYNPLINPELAMQRQAQVLEKMRKAGFLEE

Enzyme Prediction     

No EC number prediction in MGYG000002838_02459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	212	3.7e-62	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.73e-81	50	212	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	5.41e-80	50	219	4	173	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.10e-71	33	219	61	248	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.26e-70	50	217	69	236	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.64e-49	52	217	70	235	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB22227.1	4.24e-107	2	217	4	219
QEI32894.1	4.24e-107	2	217	4	219
QRT31378.1	4.24e-107	2	217	4	219
QJU22158.1	3.29e-84	2	219	7	224
QRP41835.1	1.89e-83	2	219	7	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.35e-56	47	217	19	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.15e-55	47	217	19	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	3.08e-39	55	219	46	210	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3HZS_A	1.42e-35	25	219	4	198	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.46e-35	25	219	5	199	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.17e-50	47	217	62	232	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	5.91e-45	52	217	71	236	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87626	5.53e-43	45	217	65	237	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q07259	3.68e-41	49	215	48	213	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O86088	1.15e-40	45	211	65	231	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985144	0.003349	0.011291	0.000017	0.000009	0.000225

TMHMM  Annotations     

start	end
5	22