CAZyme Information: MGYG000002845_01358

Basic Information

• Species: Lachnoclostridium_B sp900543315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B sp900543315
• CAZyme ID: MGYG000002845_01358
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000002845_10|CGC1	54467.43	4.9167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002845	2730908	MAG	United States	North America

• Gene Location: Start: 58308; End: 59717 Strand: -

Full Sequence      

MNALTRDLKHMTDMVEQTADPGSRFRQKLHLMPPVGWLNDPNGLCQFQGIYHAFFQYSPF
DVNGGVKMWGHAVSKDMIRWEYKDTALYPDQPFDCHGVYSGCALIDEGKMYLYYTGNVKL
EDKEYDYILEGREGNTVLVESPDGLTFGPKKLLMRNEDYPSDLSCHVRDPKVWKEKGHYY
MVQGVRTKDNAGQVQIFESDDRINWKPKKRISTSSPFGYMWECPDYFTVDGQNILSASVQ
GLTGGIWEERNVYQSGYFFVEGDIMTDSYLSEYQLWDYGFDFYAPQSFQAEDGRIILLAW
MGMPDCEEYGNISTIREGWQHCFTFPRELYKKDGKICQRPVRELEQWKKAEREERDYLSA
EGAKVYDIRVSGIKANRFRAVLGEELLLEYKEGYFRMEFENRDKEGTSGGRGVRRSEVAV
LRQVEILADVSSVEVFINDGELVFSTRYYPRHYSMEICCKGASIIETVF

Enzyme Prediction     

No EC number prediction in MGYG000002845_01358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	340	6.1e-87	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.69e-148	36	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	4.74e-129	8	450	1	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.51e-127	25	457	28	466	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.97e-107	30	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.18e-105	30	440	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34775.1	1.98e-238	1	464	1	470
CBL24955.1	5.00e-236	1	465	1	469
QHB24857.1	4.19e-231	1	464	1	463
QEI32364.1	4.19e-231	1	464	1	463
QRT30958.1	4.86e-230	1	464	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.77e-64	23	450	23	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	8.01e-60	7	457	16	470	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	6.24e-57	14	449	37	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	8.97e-56	14	449	37	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	8.10e-52	25	469	2	425	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	4.58e-91	26	466	29	470	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P16553	3.26e-83	18	462	16	461	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	8.62e-76	22	466	21	469	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
F8DVG5	2.96e-75	23	467	26	493	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P0DJA7	5.83e-75	23	467	26	493	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002845_01358.