CAZyme Information: MGYG000002846_01826

Basic Information

• Species: Desulfovibrio sp900540515
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio sp900540515
• CAZyme ID: MGYG000002846_01826
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		25108.38	6.7373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002846	3432213	MAG	United States	North America

• Gene Location: Start: 53911; End: 54594 Strand: +

Full Sequence      

MSDAFQLAHAFTARWEGGLSDHPSDPGGLTNHGVSLRWVQDLARQAREECRRLLRSCDGC
GERATPQCGWYSLDLDTDGDVDADDIRACTKAQAAALFKTHFWDKLNCKALSLPLAVTLY
DGAVNMGPARAVRQLQQAMNVTGEAQLDHYSPIAEDGIMGPRTLELAEALAAAHLDFYAA
RLSLRLRETFYRDLAARRPSMKVFLAGWRNRARSLAQYLAELERGAA

Enzyme Prediction     

No EC number prediction in MGYG000002846_01826.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	10	127	7e-32	0.9651162790697675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05838	Glyco_hydro_108	7.82e-23	10	127	2	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
COG3926	ZliS	7.05e-21	1	197	1	160	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	1.37e-18	3	127	1	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam09374	PG_binding_3	2.46e-07	130	212	1	75	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD89012.1	9.01e-156	1	227	1	227
VZH34560.1	3.67e-123	1	224	1	224
QCC85041.1	2.87e-120	1	226	1	226
SFV73167.1	9.12e-117	1	226	1	226
CCG07341.1	1.19e-35	16	213	18	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DNP_A	2.48e-11	7	172	10	127	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
2IS5_A	5.71e-08	16	170	17	121	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	5.80e-08	16	170	16	120	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002846_01826.