CAZyme Information: MGYG000002848_00045

Basic Information

• Species: UMGS905 sp900540085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS905; UMGS905 sp900540085
• CAZyme ID: MGYG000002848_00045
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		98512.87	6.1923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002848	1776420	MAG	United States	North America

• Gene Location: Start: 53452; End: 56001 Strand: -

Full Sequence      

MKKLLNGQWLFRELNNVEFKTASVPGCNFLDLMQNGDIPDPYIALNEKDVQWVGEKDWEY
KRTFELTNEDLEFDEILLNCKMLDTVCDIFINDCFVSNADNCFVEHSFPVKEFLKSGQNE
IRIVFFSAVKYVSQKYEKLPTPRNANGQNGIVHIRKPQYHFGWDWGPVLVSCGISDDIEL
EFVKSAKIDFVSVSQTHSEKSVKVSVNTNIKKYNCDKEVKCEISLTHPNGESQKVVGESA
EFTVENPQLWWTYELSQKKEQPLYSVKVKLFGDDDELDFSEKKIGLRTIELNREKDEYGR
NFQFVLNGVPLFIKGSNYIPPDCFITRFDENKLNSLLDAVLFSNMNMIRIWGGGYYASDE
FYNACDERGILVWQDFQFACQAYPFFEDDFLENVKTEVESVVKRICHHPSLALWNGNNEI
EDMHSGWAHMKKYVDWTEKFFYHILEPEIRKIDASTPYTQGSPIGISHNKGVCSDNVGDT
HLWTVWHGLRPMNYYRKRYTRFCSEFGFESLPDMKMIEQFAEPKDYSLSSPVFKSHQKCV
NGNEKMIYYMASRFNLPKNFEDYVYLSQVTQQECIADATEHWRRNKGRCNGSMYWQLNDC
WGVCSWSSIDYMGNYKSLQYSAKDFNAPLSVSIEDTDDYIKIFALNDFNKAKNVTVQYEI
FDFSKGTIEKSGKLVRVNAVKNKKVFELSMKSLMSKYNSKNTGLAVSLFKNDKFLMQKVF
LFNKEKDLNLPKAKINFDCYAEDGKIYINLKSDKYARFVKINSSKSTLPFSDNYFDLLPN
HSKTVTMNLDESMTVEEQIKSLSVSSLCDVEIDKNTVKTKMKQLKVFLSPINIGNAIYHG
RQSSNVKID

Enzyme Prediction     

No EC number prediction in MGYG000002848_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	741	2.6e-100	0.7446808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.65e-85	1	647	11	651	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.74e-15	732	809	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	6.29e-10	193	459	193	446	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	6.78e-09	179	287	11	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	5.37e-07	3	419	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98156.1	1.38e-219	1	833	2	847
AUG59052.1	1.29e-186	5	809	5	816
BAJ62595.1	4.19e-184	9	807	14	825
QEH70285.1	9.00e-181	5	807	6	821
ADZ84812.1	9.00e-181	5	807	6	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.94e-147	4	785	10	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.10e-147	4	785	12	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.18e-147	4	785	12	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	8.37e-147	4	785	10	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	3.44e-145	4	785	10	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	4.97e-105	5	633	9	664	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
O00462	1.20e-102	5	810	25	878	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q5B7W2	1.10e-101	4	633	8	660	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q95327	3.26e-101	5	809	25	877	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
A1CGA8	2.25e-100	24	633	32	660	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000091	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002848_00045.