CAZyme Information: MGYG000002854_00435

Basic Information

• Species: Peptacetobacter sp900539645
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter sp900539645
• CAZyme ID: MGYG000002854_00435
• CAZy Family: CBM32
• CAZyme Description: Hyaluronoglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		34564.73	4.8031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002854	2123910	MAG	United States	North America

• Gene Location: Start: 70; End: 990 Strand: +

Full Sequence      

MKKLRIDRKNKKGFQKFAAGVMALVMTVSGLTISPVRSEAAAAEYEIYPNPQVIQYTEGD
YVIKNEVNVVYESGIDQATKDRLAEALALKDGVTVTTSESIEEGKTNILVGIDGSGEVAD
TYANEHVNMQSADLYEKLDAYVLDSNDDVITVVGADTDASYYGLTTLYHILKQMDSNTIR
NFHIEDWADVASRGFIEGYYGNPWSTEDRINLMKWGGYYKLNSYFYAPKNDPKHNAKWRE
LYTEEELNTLIRPLAEAGNASKCRFVYALHTFMYNPVRFDGNYQADLKAGIFYSHLHNLK
TDLSEL

Enzyme Prediction     

EC	3.2.1.35	3.2.1.52

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	3.76e-45	193	289	1	92	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	4.44e-27	44	186	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	0.004	140	224	207	295	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW73896.1	1.59e-106	2	289	10	298
QQY28346.1	1.59e-106	2	289	10	298
QQV04685.1	1.59e-106	2	289	10	298
QPS12837.1	1.59e-106	2	289	10	298
BCL58377.1	1.88e-105	11	289	2	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV4_A	2.54e-83	45	287	32	275	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PWI_A	9.66e-64	39	288	28	276	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
4ZXL_A	1.10e-31	49	282	10	230	CpOGAD298N in complex with Drosophila HCF -derived Thr-O-GlcNAc peptide [Clostridium perfringens ATCC 13124]
5OXD_A	1.17e-31	49	282	20	240	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2YDQ_A	1.17e-31	49	282	20	240	CpOGAD298N in complex with hOGA-derived O-GlcNAc peptide [Clostridium perfringens],2YDR_A CpOGA D298N in complex with p53-derived O-GlcNAc peptide [Clostridium perfringens],2YDS_A CpOGA D298N in complex with TAB1-derived O-GlcNAc peptide [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	1.95e-79	12	287	3	282	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q0TR53	1.86e-31	11	282	3	268	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.86e-31	11	281	3	267	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	5.42e-21	102	270	70	228	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
O60502	8.42e-12	194	269	63	137	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000580	0.998478	0.000289	0.000268	0.000192	0.000162

TMHMM  Annotations     

start	end
13	35