CAZyme Information: MGYG000002857_01063

Basic Information

• Species: Hydrogeniiclostridium sp900550095
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium sp900550095
• CAZyme ID: MGYG000002857_01063
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000002857_110|CGC1	43321.4	6.026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002857	2686801	MAG	United States	North America

• Gene Location: Start: 2930; End: 4054 Strand: -

Full Sequence      

MSFIFLSADILNNFAIEKKIYMVYTHDRNAAIHLAVFVFVLGGIRMKAVSLCEAYRDYFS
IGAAVNSRSVETHADLLKVHFNSITAENEMKFERLHPEPEVYDFEKADILLRFARENGMR
MRGHTLVWHNQTPSWVFRENGLPRKKESLLAVMKDHIRRVTSHFSPNLYCWDVVNEAVED
KGSNILRRSPWLEIAGEDFLKEAFLCAKESVPEASLYYNDYNACIPEKREKICALLRRLL
EEGAPVDGFGIQGHWNITAPQPDEIRRSIEAYASLGLKLQITELDLSLYAQSDPHRPEPG
PAPEELLIRQTKLYEEIFHIFREYRDVIEAVTFWGVADDDTWLDRFFEPHRANRPLLFDE
GHKPKAAFQAVTQF

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	51	373	3.6e-104	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.01e-120	51	371	1	308	Glycosyl hydrolase family 10.
smart00633	Glyco_10	3.54e-112	90	371	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.80e-98	62	374	39	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS29875.1	1.22e-123	39	374	6	341
AZP05644.1	1.25e-123	49	374	1	326
QAY65059.1	1.52e-122	50	371	14	335
ADE08352.1	1.52e-122	51	371	12	332
QIL68818.1	8.70e-122	51	371	12	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Q8X_A	7.64e-117	50	368	7	325	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	1.08e-116	50	368	7	325	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	6.19e-116	50	368	7	325	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	8.77e-116	50	368	7	325	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
6WQW_A	2.76e-115	46	373	1	328	ChainA, Beta-xylanase [Thermobacillus composti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12603	1.57e-113	34	374	13	352	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P45703	7.00e-112	50	371	7	327	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
O69231	6.94e-110	50	371	7	328	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P23556	1.11e-108	40	374	6	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
P10474	6.09e-80	50	373	44	371	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991962	0.007977	0.000036	0.000010	0.000008	0.000031

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002857_01063.