CAZyme Information: MGYG000002857_01352

Basic Information

• Species: Hydrogeniiclostridium sp900550095
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium sp900550095
• CAZyme ID: MGYG000002857_01352
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	MGYG000002857_157|CGC1	69739.5	4.689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002857	2686801	MAG	United States	North America

• Gene Location: Start: 876; End: 2696 Strand: +

Full Sequence      

MTRFEEMKRDYMTGWKTWNNESVLSYVWMPEAVGISLGIKDYQYEKLLDTALIGQAEEEG
IVTPYAHAYDTSYTELKLDWLNNTIRVATALDGDDLVILVTPEKRPFKSSSLIVSGGSFW
NRGGVIEREEDILFLKAGEKKIPVYMTSPHTGELFVRCTNPYVSAELSGAVGISTGRKRN
LEEIRGIIERQKRRWAEGKEKYGELAEAYNAMQTCLAWDTIYNPQDDTPITTVSRLWNRR
WGGYVVFCWDTYFGALTLSMGAKELAYCNAVAITKTHTEEGFVPNFACQNGFKSYDRSQP
PVGSMACLMLYKQYGDRWFLEEVYGDLVRWNRWFYESRSTKNGLLAWGSGTYEPITGHAL
ELYDVHDRQGAAYESGLDNSPMYDDTPFDEERGILLLEDVGLTGLYIEDCRCLAEIASIL
GDTQTAEELSLRKEKLEEAMEQLWDEDFGMYLNRREDTGAFEYRLSPFHFHALFSSKVSE
ERVERILKEHFYNPDEFWGEYILPSIARNDPAFPEQTYWRGRIWAPMNFLVYMALRRHEC
GEARKALSEKSVKLILQEWLEKGHVHENYDPDTGEGCNSARSDKFYHWGGLLSFIALLEN
GYFGGV

Enzyme Prediction     

No EC number prediction in MGYG000002857_01352.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03200	Glyco_hydro_63	9.92e-16	319	595	187	491	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	5.71e-15	240	575	340	762	alpha-glucosidase; Provisional
COG1626	TreA	7.92e-07	246	494	172	452	Neutral trehalase [Carbohydrate transport and metabolism].
PLN02567	PLN02567	1.04e-06	246	570	153	511	alpha,alpha-trehalase
COG3408	GDB1	5.62e-06	244	574	282	583	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	1.19e-205	1	602	15	617
QTH44429.1	3.68e-199	2	602	15	616
QNI32096.1	1.59e-178	7	600	1	601
QLE02613.1	2.50e-173	5	602	32	622
QDO68990.1	1.33e-166	4	601	31	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7T66_A	6.01e-09	318	602	549	814	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]
5OHC_A	1.63e-08	228	579	29	433	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OHC_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],6Q5T_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199],6Q5T_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199]
5OHZ_A	1.63e-08	228	579	29	433	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - SeMet derivative [Mycolicibacterium hassiacum DSM 44199],5OHZ_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - SeMet derivative [Mycolicibacterium hassiacum DSM 44199],5OHZ_C Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - SeMet derivative [Mycolicibacterium hassiacum DSM 44199],5OHZ_D Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - SeMet derivative [Mycolicibacterium hassiacum DSM 44199]
5OI1_A	1.63e-08	228	579	29	433	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OI1_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OIW_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OIW_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJ4_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJ4_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5ONZ_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199],5ONZ_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D182A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199]
6G3N_A	1.63e-08	228	579	29	433	Mycobacterialhydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199],6G3N_B Mycobacterial hydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
K5BDL0	8.90e-08	228	579	27	431	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
P42592	8.79e-07	223	574	319	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002857_01352.