CAZyme Information: MGYG000002861_00121

Basic Information

• Species: Megasphaera sp900539295
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900539295
• CAZyme ID: MGYG000002861_00121
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MGYG000002861_1|CGC2	58902.54	9.2382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002861	2242985	MAG	United States	North America

• Gene Location: Start: 127712; End: 129271 Strand: +

Full Sequence      

MKQWLYENRYGLTVALVAAIILLPFLGAVPLTDPDEPVYGETAREMLAAGDWLSPRIFGS
YWYDKPPFFYWLEMISYSIFGVTNFASRLPSALAAMATTMYVYAAGRDVFNKPIAALSSL
LLVSSFGFMYIGKAAVTDMTLVLTLTVALMSFYRKKYYTAYIFCGLSLLVKGPIGYAFPA
FIMLIYIACTRQWPLLKEMKIPQGILLAFAVGLPWYVLMYKVHGEVFLDTFIGYHNFTRF
AAPEHPGQNSLFFFIPVLLAAMMPWTIYLAPAMRRLFKKRDPFRDPLHFCLIWAGFIFIF
FSLSKTQLVTYIAPMFPPTAYLIGWYWYRGYIERSFPRSLLAASYLLGILLLACNAIPLS
AGAEFFRPTIAWVSGGLAAALFLPTYFLWHRRYQAAFIAAAVTMVLFSWALFGAVIPGLK
SHITSYDTAQILPDVYDGHSRLYVEKFLRPGITYYSGMYGEEWDPVKNPELETLLTQDDK
IFLIMSKATFHKLAHSKPLIDRFGIAGETPSQVILINHP

Enzyme Prediction     

No EC number prediction in MGYG000002861_00121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	418	5.8e-107	0.8018518518518518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.18e-55	14	418	13	432	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.39e-37	13	417	8	429	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.32e-15	64	215	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.95e-08	39	223	35	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO73979.1	2.16e-303	1	519	1	519
CCC72524.1	2.16e-303	1	519	1	519
AVO26796.1	3.07e-303	1	519	1	519
ALG41392.1	8.78e-303	1	519	1	519
AXL21031.1	7.71e-250	1	519	1	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.78e-38	4	374	27	414	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	6.54e-36	17	334	10	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q4ZSZ0	3.02e-35	5	324	2	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
A8GDR9	1.49e-34	7	326	5	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
A0KGY4	3.48e-34	22	413	17	394	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B4ETL9	6.84e-34	31	326	31	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
67	89
109	131
157	188
201	220
251	273
286	303
308	328
341	363
368	390
397	419