CAZyme Information: MGYG000002872_00542

Basic Information

• Species: UMGS874 sp900546315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS874; UMGS874 sp900546315
• CAZyme ID: MGYG000002872_00542
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38831.76	6.0509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002872	3007809	MAG	United States	North America

• Gene Location: Start: 43269; End: 44303 Strand: +

Full Sequence      

MEKFTISRDDSVYEAFPDVALTKSGKLVCVFTECNHHADRKNSRIVLKTSCDRGRSWTEK
RPLTERSNGGMYHNCARISHLSDGRLAIVCDMINGENTADFDKTVIKLWLSTDEGESWSE
PMIIPGAHGIVPDRLVELKSGRWLVSAHRPSAEHGKLTEYLRYSDDQGKTWSDEVIVASD
ARYNLCEASLLEVAPDTVVAYLRENSVMGYDCLKAISRDGGRTWNGVYNVPLPGCHRPTA
GFLRDGRMLITYRFMQGGKGWLGTLYQNTFGAILPPESALAEKRNDQWARIFPIDFDRSH
VSDSGYTGWVQFDDGEIYVVNYIVDDSPKAFIKGYSFRAEEFLI

Enzyme Prediction     

No EC number prediction in MGYG000002872_00542.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	14	230	5.5e-25	0.6637426900584795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	9.93e-27	17	320	17	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.98e-12	52	252	27	227	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.23e-06	21	201	118	267	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.00e-04	17	124	165	257	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
smart00602	VPS10	0.006	42	191	290	439	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB46154.1	2.07e-133	1	344	3	342
ANY72719.1	2.85e-131	1	344	3	342
AVM44758.1	1.48e-128	1	344	2	345
AHF91127.1	4.32e-117	1	344	2	357
AHF89372.1	8.70e-75	3	344	4	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HX0_A	2.61e-12	1	254	45	330	ChainA, Uncharacterized protein Dfer_1899 [Dyadobacter fermentans DSM 18053],5HX0_B Chain B, Uncharacterized protein Dfer_1899 [Dyadobacter fermentans DSM 18053]
4YW1_A	8.74e-08	111	225	426	537	ChainA, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW1_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW4_A Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW4_B Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW5_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW5_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4]
4YZ1_A	8.84e-08	111	225	445	556	CrystalStructure of Streptococcus pneumoniae NanC, apo structure. [Streptococcus pneumoniae TIGR4],4YZ1_B Crystal Structure of Streptococcus pneumoniae NanC, apo structure. [Streptococcus pneumoniae TIGR4],4YZ2_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with 2-deoxy-2,3-didehydro-N-acetylneuraminic acid. [Streptococcus pneumoniae],4YZ2_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with 2-deoxy-2,3-didehydro-N-acetylneuraminic acid. [Streptococcus pneumoniae],4YZ3_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir. [Streptococcus pneumoniae TIGR4],4YZ3_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir. [Streptococcus pneumoniae TIGR4],4YZ4_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with N-Acetylneuraminic acid. [Streptococcus pneumoniae],4YZ4_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with N-Acetylneuraminic acid. [Streptococcus pneumoniae],4YZ5_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with 3-Sialyllactose [Streptococcus pneumoniae],4YZ5_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with 3-Sialyllactose [Streptococcus pneumoniae]
4Q6K_A	4.20e-06	9	224	179	415	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002872_00542.