CAZyme Information: MGYG000002872_02178

Basic Information

• Species: UMGS874 sp900546315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS874; UMGS874 sp900546315
• CAZyme ID: MGYG000002872_02178
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000002872_92|CGC1	46181.52	5.3703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002872	3007809	MAG	United States	North America

• Gene Location: Start: 4791; End: 6011 Strand: +

Full Sequence      

MRYIDLTDKTENQITVDREDGIYLGHPTTVLLDDGRTIYTVYPKGHGVGQLVMKRSDDAG
LTWSERLPVPDSFSTSLECPTIYKLTDGDCVERLFIFAGRYPFRSSVSTDNGKSWSEFSP
IVDFGGYFMSTIVETGKGEYLALFHDEGAFIHGGDTHRVEVYRAGEGADARTRQREKKLS
DDGRTWVRTSAWNLDVSENPERDGDIWRKVYETSHGDTFADGHYEVYQTRSRDGGLSWSE
PERICRTKEPTKLCEPCMIKSPDGKRIAVLLRENSRKKQSMFAVTDDNGQNWSDVKELNG
VLTGDRHCAKYLRDGRLFVSFRDMNRDSPYYQNWVAWIGSFDDILHGRDGDYKLRLKKGC
TLDCAYPGVEVLADGTVVAVTYGQWEENAKNYILCVRISGEEIKGY

Enzyme Prediction     

No EC number prediction in MGYG000002872_02178.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	9.36e-16	51	331	47	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	2.12e-13	80	399	17	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.43e-09	55	298	24	257	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	4.41e-07	24	121	111	204	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	3.07e-06	25	144	148	268	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDV35524.1	8.69e-113	4	403	42	378
ABG82852.1	3.40e-75	3	403	201	563
SQG39657.1	3.40e-75	3	403	201	563
QUD71963.1	3.40e-75	3	403	201	563
AQW27075.1	9.40e-75	3	403	201	563

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002872_02178.