CAZyme Information: MGYG000002873_01270

Basic Information

• Species: CAG-495 sp900538765
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900538765
• CAZyme ID: MGYG000002873_01270
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		69152.9	9.3162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002873	1867269	MAG	United States	North America

• Gene Location: Start: 6143; End: 7951 Strand: +

Full Sequence      

MKIFFRIFLGGLLAVHAVSVSAAEAETKRVEYQVDPQVLQQKIDADVYRLILEQGYVSRD
DVKTYKNIFKALNEGDIEEAADLSADLDNDVLAGHVLAEKYLSKDYQSTYEELKDWLLNY
ADNPQSQRIYNLAKRKAGAKAAAEDLPDPKLLRLDTYNRSLYANDMAAYENLSPARKKIV
QKNVTLFYKYLRQGKTLKARRVLENKRFRMAVPDKYWDEMSAALAQEYFLDNQDKLALQW
TLKPMRRSHNPTAYWIAGLASWRQKKISAAAGYFAKLGAMKGKDEWLEAAGAYWAYRCYD
RLKQRGNARRQLERAAVYQRTFHGILASYVLGLKIDYNWSGATYWNDFSSPDYAENLASS
SAVRRAVVLFHAKRPDLAEKELAYAYENMNEKQREAVLFLLNHNERHSMVIRLANTLHDH
EKGVFYDSLAYPVPAFLPEEMRGDKALVLAVSRQESNFNPYARSSAGACGLMQVMPNTAY
HVSGNSQDKKDLRRLFDISYNLEVGQKYLEYLLNKPYIGGNLFYMLAAYNAGPGNLVKWM
KTMRYQNDPLLFIEVIPARQTRLYIERVMANYWIYSMQLGLPGGERTLQAAADGKFPLLE
ED

Enzyme Prediction     

No EC number prediction in MGYG000002873_01270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	446	573	2.4e-27	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.53e-50	430	578	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	6.31e-38	444	572	18	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	4.78e-35	446	573	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.15e-27	444	580	153	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	8.80e-25	257	570	329	619	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10634.1	2.15e-143	6	600	4	578
AWY99815.1	5.17e-94	55	600	24	568
CDL00242.1	2.54e-89	57	600	75	605
AVM75780.1	2.54e-89	57	600	75	605
AVM79683.1	2.54e-89	57	600	75	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	2.05e-20	281	593	316	613	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	3.43e-19	281	593	316	613	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5O1J_A	7.26e-19	293	582	280	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	9.53e-19	293	582	276	562	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	9.79e-19	293	582	286	572	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.19e-19	281	593	343	640	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.19e-19	281	593	343	640	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	3.68e-19	281	580	343	630	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	2.43e-16	444	572	1436	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.43e-16	444	572	1436	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999110	0.000160	0.000168	0.000147	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002873_01270.