CAZyme Information: MGYG000002875_01810

Basic Information

• Species: CAG-873 sp900541865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900541865
• CAZyme ID: MGYG000002875_01810
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		39921.02	5.7524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002875	2551568	MAG	United States	North America

• Gene Location: Start: 17162; End: 18235 Strand: +

Full Sequence      

MRTAICLLAAALAWGAARADSTASLRAIPTDSLATPRVVAIGDQVLAYQRITGGWPKNVD
MTAPLTVAQLDSVGACKANTHDSTTDNGATTAQIRFLARLYGATGQSRFRDGVCRGIEYL
LSGQYPGGGWPQFWPEPHGYQEHITYNDGAMAATMTLLRDVALGAEPFGAEVAPDCLRRA
CREAFDRGVECILATQVVVDGRPTVWCQQHDHITLTPAKARAYELPSLCSQESAELVWLL
MDIENPDERTVNAIDCAMRWFEANKLTGVRYFRPDRRRQPDLDAELQPGDSTDVLWGRFY
DLETGRIFVCDRDGIKRDSLDELGRERRNGYSWYSTAPAFLYEKYRSWQLKRSRIEQ

Enzyme Prediction     

No EC number prediction in MGYG000002875_01810.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	49	339	9.5e-107	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	2.86e-131	49	339	1	286	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	9.70e-117	49	338	1	286	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd00688	ISOPREN_C2_like	6.79e-04	25	240	41	216	This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement. Class II terpene cyclases include squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY), these integral membrane proteins catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. The protein prenyltransferases include protein farnesyltransferase (FTase) and geranylgeranyltransferase types I and II (GGTase-I and GGTase-II) which catalyze the carboxyl-terminal lipidation of Ras, Rab, and several other cellular signal transduction proteins, facilitating membrane associations and specific protein-protein interactions. Alpha (2)-M is a major carrier protein in serum and involved in the immobilization and entrapment of proteases. PZP is a pregnancy associated protein. Alpha (2)-M and PZP are known to bind to and, may modulate, the activity of placental protein-14 in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41704.1	2.54e-134	25	348	31	354
QCP72097.1	4.14e-113	25	348	447	768
QCD38407.1	4.14e-113	25	348	447	768
ADE81193.1	2.58e-111	17	351	21	354
QVJ80268.1	2.58e-111	17	351	21	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	4.16e-61	41	353	86	408	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	5.85e-54	43	333	38	314	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	8.94e-53	43	333	38	314	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.998985	0.000194	0.000180	0.000172	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002875_01810.