CAZyme Information: MGYG000002877_00424

Basic Information

• Species: Prevotella sp900550365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550365
• CAZyme ID: MGYG000002877_00424
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	MGYG000002877_4|CGC3	81873.55	5.7786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002877	2502849	MAG	United States	North America

• Gene Location: Start: 99603; End: 101783 Strand: +

Full Sequence      

MLAGAMALGGSAMAEQVTVSTPSTALVLDATEGEELKQLYYGDRLSAADLAALNDAGGNR
YAAYPVYGTICQGETALAVKHADGNMSLEMAVEKVTTTTEGNATITRVSMKDKVYPFYVD
VCYKTYKDADVIETWTEIRHDEKGTVVLNQFASGYLPIRRGTVWLSSLYGAWANEAQVAQ
EPLEPGMKVIKNKDGIRNSHTAHAEVMFSLDGRPQENTGATIGAALCYGGNYKLRIDTDE
SEYHHFFAGINEENSMYNLQRGEVFATPALALTYSREGLSGASRNFHRWGRKYRLMHGDK
ERMILLNSWEGVYFNINQEGMDQMMADIASMGGELFVMDDGWFGGKYQRNSDNSSLGDWT
VDRRKLPEGIEGLLRDAKKNGVKFGIWIEPEATNTTSELYEKHPEWIVNAPKREPATGRG
GTQLMLDLGNPDVQDFVFGIIDNLMTKYPEIAYIKWDANMGIQSAGSTYLTKDNQSHLYI
NYHRGFESVCQRIRAKYPDLIIQACASGGARANWGVLPYFDEFWVSDNTDALQRIYMQWG
TSYFFPAIAMASHISSKPNHQTFRTTPIKYRIDVAMSGRLGMEIQPKNMTEEEKALCKKA
IAEYKEIRPVVQFGDIYRLISPYDKLGVASLMYTSEDKNKAVFYWWKTETFVNQHLPRVK
MAGLDRSKTYRVHELDRIDNNPLKFEGKTFTGAFLMDTGLEIPYTHDVDYNKLNDYASRV
LYLEAM

Enzyme Prediction     

No EC number prediction in MGYG000002877_00424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	18	701	7.2e-213	0.9941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	8.61e-135	265	614	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	2.23e-114	301	606	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.55e-109	123	679	113	655	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam16875	Glyco_hydro_36N	5.64e-41	36	260	3	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	1.03e-22	628	723	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36266.1	0.0	1	725	10	736
BBK87992.1	0.0	2	726	10	733
QQA28694.1	0.0	2	726	10	733
QUT64146.1	0.0	2	726	10	733
QUT67274.1	0.0	2	726	10	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	2.29e-118	100	726	127	727	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.29e-118	100	726	127	727	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	6.81e-117	100	726	127	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNP_A	6.81e-117	100	726	127	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNT_A	9.57e-117	100	726	127	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.25e-117	100	726	127	727	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
Q5AU92	5.59e-113	101	724	150	748	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
Q9UUZ4	4.75e-109	102	724	148	745	Alpha-galactosidase C OS=Aspergillus niger OX=5061 GN=aglC PE=1 SV=1
G1UB44	1.77e-108	97	726	128	731	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
Q2TW69	3.00e-107	99	724	148	749	Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.156784	0.840769	0.000756	0.001061	0.000339	0.000277

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002877_00424.