CAZyme Information: MGYG000002877_01290

Basic Information

• Species: Prevotella sp900550365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550365
• CAZyme ID: MGYG000002877_01290
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	MGYG000002877_17|CGC1	65294.45	5.5065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002877	2502849	MAG	United States	North America

• Gene Location: Start: 11796; End: 13598 Strand: -

Full Sequence      

MRKLILTALILICSHAAVTAGDIYVSAGGNDSAAGTADAPLKTIDAALRQAREWRRLGLS
DMTRGGISIIIRGGTYRLDSPIFIRPEDSGTPESPTVIRGEAGAETVISGGVSVTGWRKG
CDDPRLPATVRGKVWVADAPIRGNRIVYARQMYADGRKALRATQFGEYGMERMAAFSPGD
ESITIPTPKADLSGARQLEMTVHQRWAIAILRVREMKDMGNGLTKVWFHQPESRLEFAHP
WPQPVIGGERGNSSFSLNNALELLDEPGEWYQDYPSGRIYYYPEDGRTPDKMQITVPAME
TLVVIGGTRERPVSNVTFSNLAFMHAAWTRPLREGHVTLQGGFRLIDAYKLDKPGLFHKA
ELENQAWIARPEAAVTARFATGITFSGCRFSHVGATAVDFAYAVSSSAVDSCTFTDIGGT
AIMAGSFGEGGFETHIPYSPAIPSDMCDNITISGCRIDDAANEDWGCAAISAGYVSEIDI
VQNEISNVNYSGICVGWGWTAKESGMHDNRITGNYIHNYARQLYDVGGIYTLSNQPGSVI
SGNRIGLPADAPYATNDRAFCIYFDEASDGFTVENNECPKPLFGYNRPGPHMNVKEQAAD

Enzyme Prediction     

No EC number prediction in MGYG000002877_01290.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	22	579	1.2e-185	0.9905123339658444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	7.63e-12	400	576	4	132	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	3.55e-11	373	576	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.19e-05	468	578	1	87	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	2.16e-04	447	576	71	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	6.38e-269	1	594	1	595
QQY37289.1	6.34e-258	18	591	18	590
AII69040.1	8.09e-258	18	591	18	590
QUT84057.1	8.09e-258	18	591	18	590
QEW37044.1	2.35e-257	18	591	55	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.64e-160	18	589	22	595	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000408	0.998883	0.000198	0.000171	0.000166	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002877_01290.