CAZyme Information: MGYG000002877_01405

Basic Information

• Species: Prevotella sp900550365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550365
• CAZyme ID: MGYG000002877_01405
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000002877_21|CGC1	36575.57	7.8172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002877	2502849	MAG	United States	North America

• Gene Location: Start: 8701; End: 9684 Strand: +

Full Sequence      

MKKAFTILLCLLCAFTAKAANAYDNPDTIFVARDGTGQFRTVGEAVEVCRAFMDYHKVIF
VKNGVYKEKLIIPSWLTNIEICGESKDGTIITYDDHANIRMPETDKPMGTFRTYTVKVEG
NDITFKNITIENNAAKLGQAVAIHTEGDRLVFINCRLLGNQDTVYTGVGGTRLYFKDCYI
EGTTDFIFGPSTAWFENCTIHSKQNSYVTAASTPQDIAYGYVFNHCRLTAADGITKVYLG
RPWRPYGYTLFMNCELGSHIVPAGWHNWGKTSNEQTARYMEYNNTGAGAADGKRAAWSRQ
LTKKEAAKITPAEVFRMDTSWLPAEAK

Enzyme Prediction     

No EC number prediction in MGYG000002877_01405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	315	2.4e-103	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	3.27e-79	31	308	9	289	pectinesterase
pfam01095	Pectinesterase	5.85e-77	31	313	4	293	Pectinesterase.
PLN02682	PLN02682	9.76e-66	18	306	60	352	pectinesterase family protein
COG4677	PemB	5.55e-64	3	305	51	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	1.42e-60	29	307	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	6.50e-182	1	323	1	322
ADE82952.1	6.50e-182	1	323	1	322
BCS84477.1	5.66e-179	1	327	1	327
AGB28242.1	1.75e-177	1	325	1	325
QJR97878.1	3.81e-166	14	323	7	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	6.81e-46	29	324	9	310	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.71e-43	31	322	7	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	9.35e-39	31	289	13	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.04e-38	31	289	13	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	9.71e-37	39	323	18	342	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.96e-59	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.85e-52	28	309	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	3.86e-51	28	309	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	4.13e-51	28	309	259	545	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8GX86	5.95e-51	18	325	244	557	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999062	0.000207	0.000164	0.000154	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002877_01405.