CAZyme Information: MGYG000002877_01672

Basic Information

• Species: Prevotella sp900550365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550365
• CAZyme ID: MGYG000002877_01672
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000002877_30|CGC1	42616.65	6.5004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002877	2502849	MAG	United States	North America

• Gene Location: Start: 12002; End: 13126 Strand: -

Full Sequence      

MKKHILLIMLALITCMGIKAQKYLGGDISLLPTYKDKGTVFRNSDGKAECPYKIFTDAGW
NAMRVRLFVEPDNAPQANKDEGVCQDLPYVVDLCKQIKRHGFKLMLDFHYSDTWADPGKQ
FTPKTWAEAIEGKAKDEQVKILSDSVYAHTLTALNALKQAGAEPDFIQVGNEITFGMLWP
TGKVDPENNDNWDTLLTLLKAGVKACRKACPKARIIIHTEHAQDWNATQGYYDKLRDGKL
DYDIIGLSYYPMWHGTIKHLDTVLDSLKTTYGGKPVMIVETAFYYSHENDVWEKDPDHYS
DLYPISAEGQRAFTEELVTMLNRHDEVTGLFWWFPEENESGSTVVKSWLNRGLFDNHTGK
ALPAMKEFSKFIRK

Enzyme Prediction     

No EC number prediction in MGYG000002877_01672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	24	367	7e-97	0.9912280701754386

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	1.12e-94	23	368	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.30e-70	25	368	42	391	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
cd19608	GH113_mannanase-like	0.004	238	333	178	279	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT66820.1	3.71e-157	1	373	1	365
QVJ80245.1	1.54e-106	10	371	12	375
VEH14955.1	3.65e-104	22	371	47	397
AGB28452.1	6.07e-103	20	372	20	368
ADE83762.1	4.67e-101	10	371	12	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	2.15e-47	17	368	45	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	1.04e-44	17	335	19	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
1HJS_A	2.42e-44	20	370	1	331	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1FHL_A	2.54e-44	20	335	1	299	CrystalStructure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
2GFT_A	7.73e-44	17	335	19	322	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.72e-52	24	355	8	334	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q4WJ80	7.66e-46	23	335	25	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
B8NNI2	8.66e-46	9	370	6	346	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=galA PE=3 SV=1
B0XPR3	1.07e-45	23	335	25	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q2UN61	1.21e-45	9	370	6	346	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002107	0.692508	0.304384	0.000396	0.000298	0.000287

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002877_01672.