CAZyme Information: MGYG000002878_00139

Basic Information

• Species: RC9 sp900546395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546395
• CAZyme ID: MGYG000002878_00139
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833	MGYG000002878_2|CGC1	94169.08	4.7567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002878	2590775	MAG	United States	North America

• Gene Location: Start: 55668; End: 58169 Strand: +

Full Sequence      

MKRILFSFFMPLVFMSALSCSRECFVRVEDGLFVSENAPLYFIGTNFWYGPLLASDSAAG
NMDRLCKELDSLKQLGLTNLRVLVGGDGISDEMTKIKPALQTSPGKYDESVFKGLDRFLA
EIGKRDMKAVLYLNNTWEWSGGFGQYLEWAGAGDVVMPDQGWDKFRAYTSGFVTNEKAKK
MAADHIRAVVTRVNTVTGKPYAEDSAIFAWQIANEPRCFSASEDVRDAFVEWIWETAALI
KSLDSNHMVSTGNEGTAGCEESMELYERLHTCPDIDYMTIHIWPYNWSWVRKDSLAEDLD
KAIEKTGRYIDAHLEVAEKYGKPVVLEEFGFPRDGFLFTKESPVTARDKYYSYVFDRLVE
SKSEGGLLAGVNFWAWGGMACQVEGRSYWQEGDDYCGDPAQEQQGLNSVYISDNSTINII
KNAQSLLNASSGLHVKPVLENDWIYTDESGIRLGVAVRSSSLEGGDVRLCLLKDTGDTVT
VENVRFSEGKYSDTLSFRIDAVPGFYKVELSACSNGTVTSSETFNVGCSPEKIVSSADKQ
PDFDDFWNRSMKMLAEVSPEYRFEFLPEHSDSIRRTYRVEMKSFGGVKVSGIYIEPVKPG
KYPAYITYMGYGSEPWYNDPSARPEAVEFTLSIRNQALNRLPGEKDDWVVRGLEGGKDTY
YYRGAFMDVIRAIDFVCSREKTDTSRVFAEGGSQGGALTLVAASLDKRIRAVAPFVPFLS
DFPDYFKIANWPAYPVLQEARRLDITDEELYRILSYFDIKNFTDKIACPVLMGFGLQDSV
CPPHTNFAGYNRITSSKRYVTFPYAGHQVEREARWWAERDAFFKEFENQNKQY

Enzyme Prediction     

No EC number prediction in MGYG000002878_00139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	64	376	4e-97	0.9896193771626297
CE7	534	815	9.5e-73	0.9329073482428115

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05448	AXE1	9.28e-61	539	815	19	313	Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
COG3458	Axe1	6.18e-60	532	824	13	313	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
COG3934	COG3934	1.94e-39	42	443	61	473	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
COG1506	DAP2	1.14e-10	578	833	367	620	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam00326	Peptidase_S9	2.22e-07	666	825	45	208	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX74200.1	3.10e-209	302	824	2	525
QQA30547.1	8.59e-156	21	421	23	422
ADD61406.1	8.59e-156	21	421	23	422
ADD62011.1	8.59e-156	21	421	23	422
QUT33697.1	8.59e-156	21	421	23	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	1.06e-108	17	421	16	423	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
4LYP_A	2.65e-65	21	421	34	434	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYQ_A	1.85e-64	21	421	34	434	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E202A mutant [Rhizomucor miehei],4NRR_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRR_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRS_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei],4NRS_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei]
4LYR_A	1.85e-64	21	421	34	434	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]
1L7A_A	3.17e-44	542	825	23	314	structuralGenomics, crystal structure of Cephalosporin C deacetylase [Bacillus subtilis],1L7A_B structural Genomics, crystal structure of Cephalosporin C deacetylase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94388	1.74e-43	542	825	23	314	Cephalosporin-C deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=cah PE=1 SV=1
Q9FZ29	2.84e-42	6	374	8	361	Mannan endo-1,4-beta-mannosidase 1 OS=Arabidopsis thaliana OX=3702 GN=MAN1 PE=2 SV=1
Q0JKM9	1.72e-40	25	374	37	371	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
Q6Z310	3.45e-38	25	392	39	379	Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN9 PE=2 SV=2
Q9SG95	4.77e-38	25	374	29	364	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000725	0.256189	0.742620	0.000162	0.000167	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002878_00139.