CAZyme Information: MGYG000002878_01215

Basic Information

• Species: RC9 sp900546395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900546395
• CAZyme ID: MGYG000002878_01215
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000002878_33|CGC1	44970.75	4.637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002878	2590775	MAG	United States	North America

• Gene Location: Start: 22238; End: 23431 Strand: -

Full Sequence      

MMKKSISVFCAVATAVSFSFSCTRPEKNIFLERAGKTMEAIYDCYASEGTFLLRENYPFD
EEYRAGYLASQEQASKGNPYSYLWPFSGTLSAVAAIMESEPSWQDTLESRVLPGLREYLD
CSRKPCAYSSYINSAPMSDRFYDDNVWLGIDFTDLYVLTGKKDYLEQAEMIWKFIESGTD
DVLGGGIYWCEQKKHSKNTCSNAPGAVYALKLYKATGDKAYLESGKSLFDWTLSTLKDTT
DALYLDNISLDGKIADWKFAYNSGQMVQAASLLYGITGENKYLEEAQQTARACYGYFFED
YESEEGISMKILKKGNVWFSAVMLRGLIELYRIDGNSEYVDAVRNTLEVAWDKGRSEEGL
FGDSFKNVDKDKKKWLLTQGAMAEMYARFAALDISRK

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	70	370	4.2e-66	0.8324022346368715

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	7.02e-27	141	300	85	258	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	5.50e-14	138	292	88	243	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	3.15e-05	154	298	97	239	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	3.62e-04	249	365	403	515	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG1331	YyaL	0.001	143	295	405	569	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL09626.1	4.26e-180	2	394	1	393
BBL01753.1	4.26e-180	2	394	1	393
BBL12420.1	4.26e-180	2	394	1	393
AFL76817.1	1.24e-165	31	396	30	394
QGT72769.1	9.82e-163	19	394	11	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.13e-87	30	387	4	360	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	1.09e-68	32	393	5	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	7.88e-62	83	390	169	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
6SHD_A	1.35e-30	133	290	125	286	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.37e-29	133	290	126	287	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000020	1.000021	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002878_01215.