CAZyme Information: MGYG000002880_01006

Basic Information

• Species: Ruminococcus_D sp900539835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900539835
• CAZyme ID: MGYG000002880_01006
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		43257.57	4.4209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002880	1989530	MAG	United States	North America

• Gene Location: Start: 39399; End: 40550 Strand: -

Full Sequence      

MKYRKIITLAACFAMGLCWFTGCSNKDGSSENNSSSDKKDEQVMEMRDISAKELVSEMKI
GWNLGNTLDASGAEGIAAETAWGNPKTREDMIKLLKDTGFNVLRIPVTWNGHMDENYNVE
PEWMARVKEVVDYGINNDMFVILNTHHEEWYYPDSENKDEDIKQLKTLWEQIAEEFKGYD
EHLIFEGLNEPRLRNTAMEWTGGTPEAQNIINEYEQAFYDTVRNSGGNNGKRHLMITGYA
ASSQSSSLQAIKIPENDNKIIISVHGYLPYSFALDTKGTDKFDANSDAVSIDSLLLNLDS
MFLSQDIPVIIGEFGCVNKDNLKDRIECTKYYLSAAKSFGVPCIWWDNGSFVGNGENFGL
MDRQAPAEWKTPELVNAMIECVK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	79	349	3.2e-101	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.07e-70	68	351	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	7.12e-34	53	380	46	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO06082.1	2.09e-150	1	382	1	382
ADU20585.1	3.66e-144	1	375	1	391
CAA38693.1	4.36e-141	50	376	70	394
AAA26469.1	3.68e-139	50	375	68	391
CBL17440.1	2.77e-132	4	380	7	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AYR_A	2.16e-114	46	364	15	343	GH5endoglucanase EglA from a ruminal fungus [Piromyces rhizinflatus]
3AYS_A	1.74e-113	46	364	15	343	GH5endoglucanase from a ruminal fungus in complex with cellotriose [Piromyces rhizinflatus]
6WQP_A	1.07e-106	41	380	6	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6Q1I_A	1.18e-106	42	383	7	354	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6MQ4_A	7.67e-104	46	380	7	347	ChainA, cellulase [Acetivibrio cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23661	8.72e-142	50	376	70	394	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P16216	7.35e-140	50	375	68	391	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P23660	6.24e-108	45	383	21	364	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
Q12647	4.27e-105	46	380	20	361	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P54937	1.10e-104	42	383	32	379	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000052	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002880_01006.