CAZyme Information: MGYG000002881_00695

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus
• CAZyme ID: MGYG000002881_00695
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		32480.53	4.4004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002881	1270591	MAG	United States	North America

• Gene Location: Start: 1911; End: 2744 Strand: -

Full Sequence      

MEEVSYIRKITGRQPKLRGFELLSYSPNINYDDADEDCLTEIYENRGTVDTALKWAKESN
GIITFTFHWYSPIGGRGKSFYAENTDFDAEKILIEGTPERKAFFRDMDVIAKLLKEFCEE
DIPILWRPFHEADGKWFWWGAKGPEVARELYKLMFDYYTSYHKLDNLLWVWNCSLAEGYP
GDSYVDIVSMDIYLPEYSATDYSQEYFRLISATSGNKVAALAEVGYIPDIELLEKSHIPW
AYYMTWSKEFCIGEQYNHIENVRKMYESDYSVSLEVT

Enzyme Prediction     

No EC number prediction in MGYG000002881_00695.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	2	274	7.4e-87	0.8646864686468647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.28e-50	1	247	39	283	Glycosyl hydrolase family 26.
COG4124	ManB2	6.52e-16	122	226	180	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	9.81e-152	1	273	39	311
AEB13973.1	3.96e-148	1	274	39	310
QNM01251.1	1.86e-147	2	274	44	334
AIQ66101.1	1.12e-115	2	275	46	319
AZK45707.1	1.38e-115	2	275	42	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	6.24e-58	1	269	38	302	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	2.19e-52	1	275	176	445	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.05e-45	55	275	124	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	9.43e-34	1	246	81	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	1.94e-32	62	273	104	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.92e-51	6	275	210	474	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	3.81e-50	1	275	60	348	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.08e-48	2	250	184	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	3.01e-43	5	274	63	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	4.28e-38	9	257	204	440	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002881_00695.