CAZyme Information: MGYG000002884_00895

Basic Information

• Species: UMGS951 sp900547155
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS951; UMGS951 sp900547155
• CAZyme ID: MGYG000002884_00895
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000002884_10|CGC1	42094.11	8.2246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002884	2277749	MAG	Ireland	Europe

• Gene Location: Start: 20597; End: 21718 Strand: +

Full Sequence      

MKKLFIVTGELSGDTHAAAVVEQIRAQDGDIEVEAIGGANLRELGVKLFVDHSKMSAMGL
NFKILFDHIRLGKRLVEYLKNEYKPDLVLLIDYGGFNLNLSKFLKKEGIKTFYYIPPQIW
ASRKWRIKTVKKNISKVLTIFPFEKAMYEKEGIDAEFVGHPLVAQLPAPANSDDFFEKYG
LDKNKKLVSIFPGSRTFELQNLMDVFLGAAKILKEKENNVQFVISQAPSIKDETFEKYFK
NSDIPVIKNDNHALLSVSDALILASGTVALEAALYQTPMIISYRGPWFYYLVYRLVRCIN
RVCLPNIILDKDVVPEILQGDCKAEIIAENIHKLLTDEAERTAMIEDLGHVKSLLSKHQA
AKEAANIIISALK

Enzyme Prediction     

No EC number prediction in MGYG000002884_00895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	354	3.7e-108	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.22e-120	1	373	1	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.01e-104	1	369	1	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.24e-76	4	364	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.03e-73	6	368	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.84e-46	1	368	1	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	2.98e-169	1	372	1	372
VEH12442.1	4.50e-82	2	372	5	379
SNV50078.1	8.89e-78	2	373	5	380
AEG01383.1	3.83e-76	9	373	15	382
AKQ33376.1	4.81e-76	2	369	6	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.30e-47	6	369	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	9.04e-47	6	369	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	5.47e-74	2	370	7	378	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	5.47e-74	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B6J161	1.78e-73	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	2.50e-73	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9KC41	2.50e-73	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002884_00895.