CAZyme Information: MGYG000002885_00161

Basic Information

• Species: Pseudomonas_E juntendi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E juntendi
• CAZyme ID: MGYG000002885_00161
• CAZy Family: GT2
• CAZyme Description: Mannuronan synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000002885_8|CGC1	56033.03	10.1616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002885	3148284	MAG	United States	North America

• Gene Location: Start: 7733; End: 9214 Strand: +

Full Sequence      

MQRLQTVLLQCAGWLLYMSLLMLIALALPADIFDSQSKHFIFLVGAVGIWRYSMGATHFI
RGMIFLYGVYPYLRRKVQKMGSAADPSHVYLMVTSFRIEALTTAQVYSSVIREAINCGFP
TTVVCSLVEMSDELLVKSLWAKYNPPAHVKLDIVRIAGTGKRDGLAYGFRAISRMLPDEN
AVVAVIDGDTVLADGVVRKTVPWFKLYPNVGGLTTNEFCEVRGGYIMSEWHKLRFAQRHI
NMCSMALSKRVLTMTGRMSMFRASVVTNPEFIADVESDSLMHWRLGRFKFLTGDDKSSWF
SLMRLGYDTFYVPDAAINTVEHPPEKSFFKASRKLMYRWYGNNLRQNSRALGLGLRRLGL
FTSIVLFDQRVSMWTSLLGLTVAVIASLKFGLAYLLVYLLWIGITRLILTVMLLCSGHNV
GPAYPLILYYNQIIGALMKIYVFFRLDKQSWTRQPTALKRDLASFQQWFNTWSSRTMTFS
AASIFVAVLFMVV

Enzyme Prediction     

No EC number prediction in MGYG000002885_00161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	86	342	2e-55	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	9.94e-55	86	342	1	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	3.66e-21	182	402	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
cd06434	GT2_HAS	1.90e-09	160	345	64	234	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	2.28e-06	41	411	9	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	7.69e-05	135	266	43	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKL03659.1	0.0	1	493	1	493
QOH71431.1	0.0	1	493	1	493
QEQ89540.1	0.0	1	493	1	493
QDR69974.1	0.0	1	493	1	493
QOC97276.1	0.0	1	493	1	493

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q88NC5	0.0	1	493	4	496	Glycosyltransferase alg8 OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=alg8 PE=3 SV=1
Q887P9	1.67e-304	1	489	1	489	Glycosyltransferase alg8 OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=alg8 PE=3 SV=1
Q52463	8.80e-291	10	493	11	494	Mannuronan synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=alg8 PE=1 SV=2
P94199	5.50e-254	1	489	1	488	Glycosyltransferase alg8 OS=Azotobacter vinelandii OX=354 GN=alg8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
49	71
380	402
422	444
468	490