CAZyme Information: MGYG000002885_00619

Basic Information

• Species: Pseudomonas_E juntendi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E juntendi
• CAZyme ID: MGYG000002885_00619
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000002885_44|CGC1	26560.66	10.5339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002885	3148284	MAG	United States	North America

• Gene Location: Start: 3529; End: 4239 Strand: -

Full Sequence      

MLPSLVRRLFRALLWFAACSIVLVLVFRWVPPPGTALMVERKVQSWVNGDPIDLQRDWEP
WQNISDELKVAVIAGEDQKFASHWGFDIPAIQAALAYNERGGSIRGASTLTQQVAKNLFL
WSGRSWFRKGLEAWFTALIELLWSKERILEVYLNSAEWGKGVFGAQAAARYHFGVDASQL
TRQQAAQLAAVLPSPIKWSASRPSAYVASRAGWIRRQMSQLGGPSYLMQLDSSRKL

Enzyme Prediction     

No EC number prediction in MGYG000002885_00619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	218	3.3e-52	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	8.22e-135	1	231	4	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	5.71e-112	4	224	2	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.76e-79	1	225	20	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.06e-66	48	218	1	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.12e-33	60	222	71	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOH72040.1	5.05e-171	1	236	1	236
QDR70536.1	5.05e-171	1	236	1	236
QEQ90156.1	2.92e-170	1	236	1	236
QKL04312.1	8.05e-168	1	236	1	236
AJQ51330.1	7.41e-164	1	236	1	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.57e-23	64	199	28	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	3.57e-23	64	199	28	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.20e-19	63	222	46	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	7.31e-19	55	220	155	325	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	7.37e-19	55	220	176	346	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0KN61	2.10e-164	1	236	1	236	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mtgA PE=3 SV=1
Q88CS3	8.22e-162	1	236	1	236	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=mtgA PE=3 SV=1
A5WAE0	2.36e-161	1	236	1	236	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=mtgA PE=3 SV=1
B1J2G5	1.52e-157	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain W619) OX=390235 GN=mtgA PE=3 SV=1
Q1IGD6	8.82e-157	1	236	1	236	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31