CAZyme Information: MGYG000002885_02483

Basic Information

• Species: Pseudomonas_E juntendi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E juntendi
• CAZyme ID: MGYG000002885_02483
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183		20059.37	8.1434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002885	3148284	MAG	United States	North America

• Gene Location: Start: 7; End: 558 Strand: +

Full Sequence      

MPGSRGGEVGRLGALFLDAAERLCHHVPGVRFVLPCANAARRAQVEQMLEGRQLPLMLLD
GQSHQALAACDAVLIASGTATLEALLYKRPMVVAYRLAPLTYWILKRLVKSPYVSLPNLL
AQRELVPELLQDAATSEALANTLVPLLRDGSRQTERFDEIHRTLRRDASNQAAEAVLALL
KDC

Enzyme Prediction     

No EC number prediction in MGYG000002885_02483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	164	1.7e-56	0.4604519774011299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.79e-89	1	181	192	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.50e-69	1	181	194	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.43e-54	1	176	191	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	3.20e-18	1	141	173	311	lipid-A-disaccharide synthase.
PRK01021	lpxB	6.77e-06	2	130	420	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOH68726.1	3.30e-120	1	182	193	374
QEQ86906.1	1.34e-119	1	182	193	374
QDR67155.1	1.90e-119	1	182	193	374
QKL00899.1	2.69e-119	1	182	193	374
QIG20209.1	2.76e-114	1	182	193	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.22e-45	1	179	197	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.22e-45	1	179	197	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5W837	1.28e-113	1	182	193	374	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxB PE=3 SV=1
B0KSB2	3.66e-113	1	182	193	374	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxB PE=3 SV=1
Q88MG7	4.22e-112	1	182	193	374	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxB PE=3 SV=1
B1JBP7	1.06e-107	1	182	193	374	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain W619) OX=390235 GN=lpxB PE=3 SV=1
Q1I639	7.00e-106	1	182	193	374	Lipid-A-disaccharide synthase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002885_02483.