CAZyme Information: MGYG000002885_02491

Basic Information

• Species: Pseudomonas_E juntendi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E juntendi
• CAZyme ID: MGYG000002885_02491
• CAZy Family: GT2
• CAZyme Description: Dimodular nonribosomal peptide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873		94549.84	4.7148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002885	3148284	MAG	United States	North America

• Gene Location: Start: 432; End: 3053 Strand: -

Full Sequence      

MCAAATPDVAPVTPQRTSVAELIAAQAQRRGDAIAVVCGGQQLSFDALERRANQLAQVLV
ARGIGPESRVGVALERSVQSIVAFYAVLKAGAAYVPLDIDYPRERLEWIIQDSGMALLLS
HSALLPSLPVTPGSECLALDELDLAAQPARALQVPVQAHNLAYMIYTSGSTGQPKGVAVS
HGPLSMHCQAIIARYGMDRDTRELLFMSFAFDGAQERWLSTLLAGGRLVMRDNQLWTAEQ
TLRTLREQAISIACFPPAYLQQLAEQAALETVAPPAVHTYCFGGDAVAQATFEQVKASLQ
PRYLTNGYGPTETVVTPLLWRVAGDQPCGGPIAPIGEAVGARELYVLDDQLNLLPDGVAG
ELYIGGEGLARGYHQRPGLTAERFVASPFQAGGRLYRSGDLVRRRADGIYDYLGRLDQQV
KIRGFRIELGEIEARLRDCESVRDAVVSVQGEGADKRLVGYVTSTAASPDIGEALREQLR
AVLPDYMVPARILLLDALPLNPNGKVDRKALPDPDCSEPEALYVAPRNLFEEQLAQIWAD
VLGVERVGVTDNFFERGGDSLRSLKVISRVRSLQREGFELKLRDLMSRPTIAELSGYSEP
AAGELDPLLLLNDPVSDVPPLFCLHAGYGTVFDYEPLARHLKGECSVYGVQCRMLLDPDW
QDESLASMAIDYAQYIRQKQPDGPYRLLGWSLGGVLAVLVAAELRQQGQVVEHVSLVDSF
IPLEPAQQASAEAFDWREELAGFCQVMNVAQPAGSLPSNFEATALPSLPQLTAYFANGIV
SDTGFDAEDLAEGFIVGLRLRDLSLQALALPKLAGPVSFWWAQAVPGAAQAGFERHVAVE
VARFALDSDHYGILRHPSLLVGLGGALARKVSA

Enzyme Prediction     

No EC number prediction in MGYG000002885_02491.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17649	A_NRPS_PvdJ-like	0.0	32	512	2	450	non-ribosomal peptide synthetase. This family of the adenylation (A) domain of nonribosomal peptide synthases (NRPS) includes pyoverdine biosynthesis protein PvdJ involved in the synthesis of pyoverdine, which consists of a chromophore group attached to a variable peptide chain and comprises around 6-12 amino acids that are specific for each Pseudomonas species, and for which the peptide might be first synthesized before the chromophore assembly. Also included is ornibactin biosynthesis protein OrbI; ornibactin is a tetrapeptide siderophore with an l-ornithine-d-hydroxyaspartate-l-serine-l-ornithine backbone. The adenylation domain at the N-terminal of OrbI possibly initiates the ornibactin with the binding of N5-hydroxyornithine. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
PRK12467	PRK12467	0.0	14	596	1571	2161	peptide synthase; Provisional
PRK12316	PRK12316	0.0	14	632	2000	2614	peptide synthase; Provisional
cd05930	A_NRPS	0.0	32	511	2	444	The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
PRK12316	PRK12316	0.0	14	603	4548	5144	peptide synthase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ75991.1	5.65e-128	14	861	2703	3552
BAZ00088.1	5.65e-128	14	861	2703	3552
BAY30132.1	7.26e-126	14	726	2705	3427
BAY90071.1	6.07e-125	14	861	2694	3543
QND46664.1	6.77e-124	8	718	2064	2784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U89_A	3.45e-111	21	678	28	687	Crystalstructure of a cross-module fragment from the dimodular NRPS DhbF [Geobacillus sp. Y4.1MC1]
4D4G_A	1.49e-105	16	549	29	572	Understandingbi-specificity of A-domains [Planktothrix agardhii],4D4H_A Understanding bi-specificity of A-domains [Planktothrix agardhii],4D4I_A Understanding bi-specificity of A-domains [Planktothrix agardhii],4D56_A Understanding bi-specificity of A-domains [Planktothrix agardhii],4D57_A Understanding bi-specificity of A-domains [Planktothrix agardhii]
5ES5_A	4.01e-102	21	604	207	771	Crystalstructure of the initiation module of LgrA in the 'open' and 'closed ' adenylation states [Brevibacillus parabrevis],5ES5_B Crystal structure of the initiation module of LgrA in the 'open' and 'closed ' adenylation states [Brevibacillus parabrevis],5ES8_A Crystal structure of the initiation module of LgrA in the thiolation state [Brevibacillus parabrevis],5ES8_B Crystal structure of the initiation module of LgrA in the thiolation state [Brevibacillus parabrevis],5ES9_A Crystal structure of the LgrA initiation module in the formylation state [Brevibacillus parabrevis],5ES9_B Crystal structure of the LgrA initiation module in the formylation state [Brevibacillus parabrevis]
2VSQ_A	8.88e-102	32	720	479	1149	Structureof surfactin A synthetase C (SrfA-C), a nonribosomal peptide synthetase termination module [Bacillus subtilis]
4ZXH_A	3.76e-101	22	785	486	1254	ChainA, ABBFA_003403 [Acinetobacter baumannii AB307-0294],4ZXI_A Chain A, Tyrocidine synthetase 3 [Acinetobacter baumannii AB307-0294]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45745	1.24e-128	26	726	1523	2240	Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbF PE=1 SV=4
Q70LM5	5.92e-128	14	606	5639	6217	Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis OX=54914 GN=lgrC PE=3 SV=1
P0DUV3	5.74e-123	14	719	4697	5404	Malpicyclin synthetase OS=Mortierella alpina OX=64518 GN=mpcA PE=1 SV=1
P0DUV4	5.75e-123	14	719	4707	5414	Malpibaldin synthetase OS=Mortierella alpina OX=64518 GN=mpbA PE=1 SV=1
Q70LM4	7.67e-123	26	599	3053	3616	Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis OX=54914 GN=lgrD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002885_02491.