CAZyme Information: MGYG000002886_01123

Basic Information

• Species: Stenotrophomonas maltophilia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia
• CAZyme ID: MGYG000002886_01123
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872	MGYG000002886_34|CGC1	96918.74	6.7358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002886	4276654	MAG	United States	North America

• Gene Location: Start: 7534; End: 10152 Strand: +

Full Sequence      

MHRLSLVVRLLLLLIAASAFPATAAPLQAQWEFRMLPGDAQGAAHPGLQQWRAAKVPGSV
HTDLLAHALIRDPYVGAPEAELQWIGLAAWEYRARFDVDAATLAKPNAELRFDGLDTYAE
VSLNGRPLLSADNAHRTWRARVDGRLRANGNELQIVFRSPIRTLLPDVQAMPHKIAGNYP
SPYGDEPKDAMVGNFARKPAYHFGWDWGPRYVTAGVWRGVDLQAWDAHRLTDLAVRTDAL
SAEQAKLAVLLEMEQGAAAGSAVVNVDVRDPQGRIVAQVQRTVLLKPGQNAVEVPVELVK
PQRWWPVGHGAQDRYTVQARLDGGADAALVREQRIGLRTVELRREQDGKGGQGFAFVING
VEIFAKGANVIPFDAFPARVDAARLRQVLTAARDANMNMLRNWGGGYYEDDAFFDIADEL
GLLVWQDFMFGGGMQPGYDPAFRASVVAEARDNVRRLRHHPSIVLWCGNNEEETAWKDWG
HGRDLKAADPAFAAKVWQGYVDLFGNDLRRVVGEEGLGVPYWSSSPSNDLDEKANDSTRG
DKHYWQVWGNPALPVQAYLRETPRFMSEYGLQAWPSVATVDQIATRAEQRIDSPVIRAHQ
KFMAGEGNSRLLHYIELGYGTPKDFEDFVYLSQVMQADGIALAALHHRASRPYTMGSLYW
QLNDVWPGASWSSVDYFGRWKALHYAARRFFAPVTLAALRDEGSTRVRLINDGAAADARW
RLRVMDVDGKVLRRREDAVALTAAGVTSIGDFRDAELLAGADPKRTVAVFELLQNGAVSA
RQVVGFVEAKDQVLPRQKLKATLSIEGDHYRLRLDSAAYVRATWIDFGALDVQVEDNLLD
LLPGETRDIAVRGPVDLTTLREAMKLKTLNDR

Enzyme Prediction     

No EC number prediction in MGYG000002886_01123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	818	1.8e-108	0.7699468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.89e-116	26	849	14	782	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.87e-12	706	791	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	4.72e-10	798	871	3	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.14e-09	229	338	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	1.31e-08	31	474	19	420	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGL71783.1	0.0	1	872	1	872
QNG68081.1	0.0	1	872	1	872
QGL67635.1	0.0	1	872	1	872
SQG10410.1	0.0	1	872	1	872
QNG82450.1	0.0	1	872	1	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.18e-299	23	869	4	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.22e-299	23	869	4	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	8.87e-299	23	869	2	848	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	9.18e-299	23	869	4	850	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
7OP6_A	2.26e-170	27	867	13	843	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	6.60e-114	21	853	3	840	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q29444	1.60e-113	6	871	1	877	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	8.47e-113	6	871	1	877	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q8K2I4	1.65e-112	54	837	42	842	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
Q4FZV0	4.94e-110	54	712	42	709	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000341	0.998905	0.000176	0.000200	0.000175	0.000156

TMHMM  Annotations     

start	end
5	27