CAZyme Information: MGYG000002886_01569

Basic Information

• Species: Stenotrophomonas maltophilia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia
• CAZyme ID: MGYG000002886_01569
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000002886_58|CGC1	71034.59	7.664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002886	4276654	MAG	United States	North America

• Gene Location: Start: 7688; End: 9679 Strand: -

Full Sequence      

MAQHDYSRKEVLDIVEQVARQKGLPVDDFMRFAHIETGGTFNERAHNTSSGAKGLFQFVP
GSARQYHLTGHEFDPTRNTEAAAKMYQDNLDSMARRNERTGHPYLSGGSTPTGLDLYLAH
QQGSAGYGSVQTAIATGTFGVVRNGHGEEINMRRNVLNQIGSDAKALTGHTLAEMRGMND
GELARAFSSYYIHKYAAISIPEKNIAPQTVAPGQSQAPAAPAQASAAVAAGAATLAATTA
AATAPKPGIELHAAYEAGVKYDHVKYAINIPGHALYVPGKTGKNVEQGYIDCSGWVGTLQ
NRTMDEINQKAGHAVFSKADRIDLGNLGSGGIVRKAFDQSGVLLDRDAILKPGALKEGMI
IGLDTARTRHEHWNGIDHIVMVVRDPTTDKLLISQSTGSKGVHTMPVEDYLKQVKEHPNW
KLYASDPLSKARDLLENRTPSHEQAQGKPAAEHKAAATPHAELYKQGAHSEGVRKVQEQL
GHLGYVGADGKPLVEDGRFGRNTDAAVRQLQKDNGLVVDGIVGAKTLEAIKEARERPLLN
DERHPRNPLFIQASKGLELLPAGTFKDRHALESAAAALTKEAHAAGLQRIDSVVPSPNGE
RLFAVQGTIGDPAASRVAVETRAASEQSIALSSGAVQGAPNVLHQQQDAQQEQARQAQKA
MGV

Enzyme Prediction     

No EC number prediction in MGYG000002886_01569.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	8.66e-14	469	530	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
cd16894	MltD-like	1.09e-11	20	159	2	115	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG3409	PGRP	1.25e-06	465	537	40	109	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	1.39e-06	23	74	2	48	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG3409	PGRP	1.40e-06	470	530	127	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG69512.1	0.0	1	663	1	663
QGL73938.1	0.0	1	663	1	663
QGL69794.1	0.0	1	663	1	663
SQG08734.1	0.0	1	663	1	663
QJC76554.1	0.0	1	663	1	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MU9_A	2.40e-13	539	633	4	99	ChainA, VirD4 interacting protein conserved domain [Xanthomonas citri pv. citri str. 306]
7RUM_A	9.07e-07	460	533	21	88	ChainA, Endolysin [Salmonella phage GEC_vB_GOT],7RUM_B Chain B, Endolysin [Salmonella phage GEC_vB_GOT]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002886_01569.